BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0001_B04 (572 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 02_01_0628 + 4717963-4718175,4718719-4718857,4719514-4719740,471... 30 1.1 09_06_0041 - 20440266-20441381 29 2.6 09_06_0295 + 22099791-22100030,22100681-22100797,22100886-22102616 29 3.5 03_05_0351 - 23382786-23382821,23383373-23383634,23384369-233856... 28 4.6 03_05_1122 + 30546314-30549277,30549615-30549693,30549857-305499... 27 8.0 >02_01_0628 + 4717963-4718175,4718719-4718857,4719514-4719740, 4719825-4719998,4720090-4720176 Length = 279 Score = 30.3 bits (65), Expect = 1.1 Identities = 13/29 (44%), Positives = 21/29 (72%) Frame = -1 Query: 461 SVLKIIDSLESEQQKERHHKTEETHSLRQ 375 +VLK +++ E+QKE +T+E HSL+Q Sbjct: 210 AVLKRAVAIQHERQKEFDERTQEVHSLKQ 238 >09_06_0041 - 20440266-20441381 Length = 371 Score = 29.1 bits (62), Expect = 2.6 Identities = 13/22 (59%), Positives = 14/22 (63%), Gaps = 1/22 (4%) Frame = +1 Query: 319 PGTPPLNNSCSHMPS-WVSPCL 381 PG PPLNNS PS W+ P L Sbjct: 349 PGAPPLNNSSLIRPSVWIFPSL 370 >09_06_0295 + 22099791-22100030,22100681-22100797,22100886-22102616 Length = 695 Score = 28.7 bits (61), Expect = 3.5 Identities = 12/41 (29%), Positives = 21/41 (51%) Frame = +2 Query: 77 QDCYLQQHSSCATTRSSAYTHTDXXXXXXXXXXXAHLPDHL 199 ++C+ ++ S A + S + HTD A++PDHL Sbjct: 365 KECFTEEDSENARQKQS-FNHTDMVFSGLGNSNRAYMPDHL 404 >03_05_0351 - 23382786-23382821,23383373-23383634,23384369-23385675, 23385776-23386290,23386379-23386741,23386916-23387284, 23387365-23388057,23388152-23388238,23388354-23388612 Length = 1296 Score = 28.3 bits (60), Expect = 4.6 Identities = 10/37 (27%), Positives = 21/37 (56%) Frame = +2 Query: 8 GCQSSHPSKHKNAVCRKIDRPCSQDCYLQQHSSCATT 118 G +S+H ++H + D+PC+Q L+ C+++ Sbjct: 227 GERSAHLARHNELYATRRDKPCAQSIALECPEDCSSS 263 >03_05_1122 + 30546314-30549277,30549615-30549693,30549857-30549945, 30550422-30550538,30550873-30551111,30552279-30552365, 30552732-30552831,30553319-30553532,30553617-30553777 Length = 1349 Score = 27.5 bits (58), Expect = 8.0 Identities = 12/38 (31%), Positives = 18/38 (47%) Frame = -1 Query: 149 NNLCVCRHCCEWSHKSCVAEDSSPGCRGDQSCGIQHFC 36 ++LC C C E H C E ++ Q+C + FC Sbjct: 1003 SSLCTCSQCEEKYHPGCSPETTNTSNVSSQACDL--FC 1038 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,340,680 Number of Sequences: 37544 Number of extensions: 298886 Number of successful extensions: 892 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 860 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 892 length of database: 14,793,348 effective HSP length: 78 effective length of database: 11,864,916 effective search space used: 1328870592 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -