BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0001_B02 (318 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. 24 0.33 AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. 24 0.33 AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory recept... 23 1.0 AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory recept... 22 1.4 AY600514-1|AAT11862.1| 242|Tribolium castaneum iroquois-like pr... 20 5.5 >AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. Length = 790 Score = 24.2 bits (50), Expect = 0.33 Identities = 10/41 (24%), Positives = 23/41 (56%) Frame = +3 Query: 36 KRPMSAYMLWLNSAREQIKSEHPGLKVTEIAKKGGEMWKSM 158 K+P++A+ML++ R ++ +E + I + G W ++ Sbjct: 480 KKPLNAFMLYMKEMRAKVVAECTLKESAAINQILGRRWHAL 520 >AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. Length = 682 Score = 24.2 bits (50), Expect = 0.33 Identities = 10/41 (24%), Positives = 23/41 (56%) Frame = +3 Query: 36 KRPMSAYMLWLNSAREQIKSEHPGLKVTEIAKKGGEMWKSM 158 K+P++A+ML++ R ++ +E + I + G W ++ Sbjct: 372 KKPLNAFMLYMKEMRAKVVAECTLKESAAINQILGRRWHAL 412 >AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory receptor candidate 46 protein. Length = 1451 Score = 22.6 bits (46), Expect = 1.0 Identities = 12/37 (32%), Positives = 18/37 (48%) Frame = -3 Query: 217 SLAYCSLALAAFSSQILLSFIDFHISPPFLAISVTFS 107 +L YCSLA+ ++ I+ P L I V+ S Sbjct: 412 ALVYCSLAIFVLCELLIEGTTSILINVPSLIIHVSTS 448 >AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory receptor candidate 19 protein. Length = 355 Score = 22.2 bits (45), Expect = 1.4 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = -1 Query: 189 LLSLPKYFYLSLISTFHLLFWL 124 LL + ++Y +I T HLLF L Sbjct: 110 LLCVYYFYYAFIIFTVHLLFLL 131 Score = 20.6 bits (41), Expect = 4.1 Identities = 10/17 (58%), Positives = 12/17 (70%), Gaps = 1/17 (5%) Frame = -1 Query: 171 YFYLS-LISTFHLLFWL 124 YFY + +I T HLLF L Sbjct: 148 YFYCAFIIFTVHLLFLL 164 Score = 20.6 bits (41), Expect = 4.1 Identities = 9/21 (42%), Positives = 13/21 (61%) Frame = -1 Query: 192 WLLSLPKYFYLSLISTFHLLF 130 +LL + +F +I T HLLF Sbjct: 162 FLLCIYHFFCAFIIFTMHLLF 182 >AY600514-1|AAT11862.1| 242|Tribolium castaneum iroquois-like protein protein. Length = 242 Score = 20.2 bits (40), Expect = 5.5 Identities = 7/12 (58%), Positives = 11/12 (91%) Frame = +3 Query: 3 MRKKNKMTDKPK 38 ++K+NKMT +PK Sbjct: 142 LKKENKMTWEPK 153 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 67,189 Number of Sequences: 336 Number of extensions: 1168 Number of successful extensions: 7 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 122,585 effective HSP length: 49 effective length of database: 106,121 effective search space used: 5942776 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 38 (20.3 bits)
- SilkBase 1999-2023 -