BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0001_A24 (409 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_51711| Best HMM Match : GTP_EFTU_D3 (HMM E-Value=0) 216 5e-57 SB_8918| Best HMM Match : GTP_EFTU (HMM E-Value=1.09301e-43) 48 3e-06 SB_31292| Best HMM Match : GTP_EFTU_D3 (HMM E-Value=0.0015) 39 0.001 SB_49646| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.27 SB_30644| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.84 SB_39367| Best HMM Match : RVT_1 (HMM E-Value=2.3e-26) 29 1.1 SB_25386| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.5 SB_44859| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.9 SB_30566| Best HMM Match : zf-C4_Topoisom (HMM E-Value=0.38) 29 1.9 SB_24257| Best HMM Match : DUF583 (HMM E-Value=0.16) 29 1.9 SB_20812| Best HMM Match : rve (HMM E-Value=1.2e-25) 28 2.6 SB_51982| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 2.6 SB_6095| Best HMM Match : 7tm_1 (HMM E-Value=0.013) 28 2.6 SB_50612| Best HMM Match : RVT_1 (HMM E-Value=2.3e-26) 28 3.4 SB_48736| Best HMM Match : RVT_1 (HMM E-Value=1.4e-11) 28 3.4 SB_45778| Best HMM Match : Exo_endo_phos (HMM E-Value=1e-10) 28 3.4 SB_29742| Best HMM Match : zf-CCHC (HMM E-Value=3.4e-05) 28 3.4 SB_21418| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.4 SB_10446| Best HMM Match : Exo_endo_phos (HMM E-Value=6.6e-20) 28 3.4 SB_8311| Best HMM Match : RVT_1 (HMM E-Value=3.9e-29) 28 3.4 SB_55599| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.4 SB_45671| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.4 SB_36722| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.4 SB_26322| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.4 SB_17484| Best HMM Match : Pox_A32 (HMM E-Value=0.025) 28 3.4 SB_8103| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 4.5 SB_47012| Best HMM Match : ScdA_N (HMM E-Value=5.3) 27 4.5 SB_48433| Best HMM Match : Ion_trans (HMM E-Value=6.1e-26) 27 5.9 SB_35253| Best HMM Match : Extensin_2 (HMM E-Value=0.078) 27 5.9 SB_56699| Best HMM Match : ResIII (HMM E-Value=0.053) 27 5.9 SB_45072| Best HMM Match : Kazal_2 (HMM E-Value=5.8e-06) 27 5.9 SB_42068| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.9 SB_15632| Best HMM Match : CBM_5_12 (HMM E-Value=2.9) 27 7.8 SB_4087| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.8 SB_3096| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.8 SB_58114| Best HMM Match : DUF1478 (HMM E-Value=3) 27 7.8 SB_51131| Best HMM Match : ResIII (HMM E-Value=0.36) 27 7.8 SB_26806| Best HMM Match : Annexin (HMM E-Value=0) 27 7.8 SB_21811| Best HMM Match : DNA_pol_B_2 (HMM E-Value=3.7e-06) 27 7.8 SB_20319| Best HMM Match : IncA (HMM E-Value=0.2) 27 7.8 >SB_51711| Best HMM Match : GTP_EFTU_D3 (HMM E-Value=0) Length = 322 Score = 216 bits (528), Expect = 5e-57 Identities = 97/133 (72%), Positives = 114/133 (85%) Frame = +1 Query: 10 VAGDSKNNPPRGAADFTAQVIVLNHPGQISNGYTPVLDCHTAHIACKFAEIKEKVDRRTG 189 VAGD KNNPP+ FTAQVIV+NHPG+I GY+PVLDCHTAHIACKF ++ EK+DRR+G Sbjct: 184 VAGDFKNNPPKPCKSFTAQVIVMNHPGEIHAGYSPVLDCHTAHIACKFDKLLEKIDRRSG 243 Query: 190 KSTEDNPKSIKSGDAAIVNLVPSKPLCVESFQEFPPLGRFAVRDMRQTVAVGVIKAVNFK 369 K EDNPK IK+GDAA+V ++PSKP+CVE+F EFPPLGRFAVRDM+QTVAVGVIK+V+ Sbjct: 244 KKLEDNPKMIKTGDAAMVEMIPSKPMCVETFTEFPPLGRFAVRDMKQTVAVGVIKSVDKT 303 Query: 370 EAGGGKVTKAAEK 408 EA GGK TKAA K Sbjct: 304 EAAGGKTTKAATK 316 >SB_8918| Best HMM Match : GTP_EFTU (HMM E-Value=1.09301e-43) Length = 547 Score = 48.0 bits (109), Expect = 3e-06 Identities = 19/50 (38%), Positives = 29/50 (58%) Frame = +1 Query: 172 VDRRTGKSTEDNPKSIKSGDAAIVNLVPSKPLCVESFQEFPPLGRFAVRD 321 +D++TGK + P+ IK AI L +C+E F +F +GRF +RD Sbjct: 496 IDKKTGKKGQTRPRFIKQDQIAIARLETQGVICIEKFSDFQQMGRFTLRD 545 >SB_31292| Best HMM Match : GTP_EFTU_D3 (HMM E-Value=0.0015) Length = 80 Score = 39.1 bits (87), Expect = 0.001 Identities = 18/39 (46%), Positives = 26/39 (66%) Frame = +1 Query: 235 AIVNLVPSKPLCVESFQEFPPLGRFAVRDMRQTVAVGVI 351 A V L S+P+CVE ++++ LGRF +R T+A GVI Sbjct: 40 AEVELQTSRPVCVELYKDYKDLGRFMLRYGGNTIAAGVI 78 >SB_49646| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 624 Score = 31.5 bits (68), Expect = 0.27 Identities = 18/56 (32%), Positives = 26/56 (46%) Frame = +1 Query: 109 TPVLDCHTAHIACKFAEIKEKVDRRTGKSTEDNPKSIKSGDAAIVNLVPSKPLCVE 276 TPVL TAH+ K ++ + D P ++KS ++VN V S L E Sbjct: 223 TPVLRIKTAHVTDKDNRVRSVLIIDNISQAPDTPATLKSSSDSVVNSVGSVGLVAE 278 >SB_30644| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1887 Score = 29.9 bits (64), Expect = 0.84 Identities = 14/34 (41%), Positives = 16/34 (47%) Frame = +2 Query: 137 T*PANLPKSKRKSTVVLVNQQRTTLNPLNLVMPP 238 T PA P + RK+T Q RTT P PP Sbjct: 1459 TVPATKPPTTRKTTTATTTQGRTTRKPTTTAEPP 1492 >SB_39367| Best HMM Match : RVT_1 (HMM E-Value=2.3e-26) Length = 903 Score = 29.5 bits (63), Expect = 1.1 Identities = 12/30 (40%), Positives = 20/30 (66%) Frame = +1 Query: 241 VNLVPSKPLCVESFQEFPPLGRFAVRDMRQ 330 +++VP++P CV SF EF + +RD+ Q Sbjct: 380 MSVVPAQPQCVASFPEFCAVSVSYIRDLSQ 409 >SB_25386| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 695 Score = 29.1 bits (62), Expect = 1.5 Identities = 16/43 (37%), Positives = 27/43 (62%) Frame = +1 Query: 136 HIACKFAEIKEKVDRRTGKSTEDNPKSIKSGDAAIVNLVPSKP 264 HIA K E+K D ++ K+ + PK++ SGD ++VP++P Sbjct: 74 HIAKKL-EVK---DSQSSKNNDLYPKTVPSGDIGTDSVVPNQP 112 >SB_44859| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 650 Score = 28.7 bits (61), Expect = 1.9 Identities = 10/39 (25%), Positives = 21/39 (53%) Frame = +2 Query: 182 VLVNQQRTTLNPLNLVMPPLSTWFPPSPCVWSPSRNSHP 298 + + +Q + P PP ++PP+P + P++ S+P Sbjct: 163 LFILRQHPSYPPTQPFYPPTQPFYPPTPSSYPPTQPSYP 201 >SB_30566| Best HMM Match : zf-C4_Topoisom (HMM E-Value=0.38) Length = 597 Score = 28.7 bits (61), Expect = 1.9 Identities = 13/31 (41%), Positives = 17/31 (54%), Gaps = 2/31 (6%) Frame = -1 Query: 319 HARRNDRGVGIPGRTPHTGAWR--EPG*QWR 233 +A+ GV + GR P G WR PG +WR Sbjct: 19 YAKAVPSGVKLVGRNPRYGEWRHKRPGYEWR 49 >SB_24257| Best HMM Match : DUF583 (HMM E-Value=0.16) Length = 3999 Score = 28.7 bits (61), Expect = 1.9 Identities = 13/35 (37%), Positives = 21/35 (60%) Frame = -2 Query: 246 VDNGGITRFNGFRVVLC*FTSTTVDFLFDFGKFAG 142 VDN G+ N F V++C T+D++FD + +G Sbjct: 1700 VDNAGMYAENAFTVLVC--DRNTIDYIFDEVQLSG 1732 >SB_20812| Best HMM Match : rve (HMM E-Value=1.2e-25) Length = 1097 Score = 28.3 bits (60), Expect = 2.6 Identities = 12/32 (37%), Positives = 16/32 (50%) Frame = -3 Query: 347 TPTATVCLMSRTAKRPRGGNSWKDSTHRGLEG 252 TP+ VCL+SR + PR W R + G Sbjct: 282 TPSLYVCLLSRAHRDPRLSTGWSPYEKREVRG 313 >SB_51982| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 260 Score = 28.3 bits (60), Expect = 2.6 Identities = 19/49 (38%), Positives = 25/49 (51%), Gaps = 2/49 (4%) Frame = +1 Query: 190 KSTEDNPKSIKSGDAAIVNLVPSKPLCVESFQEFPP--LGRFAVRDMRQ 330 KST+DN S S A V SK + V S +E PP + R V ++Q Sbjct: 57 KSTKDNGNSKGSSSRASERGVGSKQVSVSSLKEAPPRVVKRHTVSSLQQ 105 >SB_6095| Best HMM Match : 7tm_1 (HMM E-Value=0.013) Length = 872 Score = 28.3 bits (60), Expect = 2.6 Identities = 14/26 (53%), Positives = 15/26 (57%) Frame = +3 Query: 81 SPRSNIKRIHTCIGLPHSPHSLQICR 158 SP+ KR T GLP S HSL CR Sbjct: 537 SPKMKKKRPKTGEGLPGSKHSLDSCR 562 >SB_50612| Best HMM Match : RVT_1 (HMM E-Value=2.3e-26) Length = 904 Score = 27.9 bits (59), Expect = 3.4 Identities = 11/30 (36%), Positives = 20/30 (66%) Frame = +1 Query: 241 VNLVPSKPLCVESFQEFPPLGRFAVRDMRQ 330 ++++P++P CV SF EF + +RD+ Q Sbjct: 381 MSVMPAQPQCVASFPEFCAVSVSYIRDLLQ 410 >SB_48736| Best HMM Match : RVT_1 (HMM E-Value=1.4e-11) Length = 1175 Score = 27.9 bits (59), Expect = 3.4 Identities = 11/30 (36%), Positives = 19/30 (63%) Frame = +1 Query: 241 VNLVPSKPLCVESFQEFPPLGRFAVRDMRQ 330 +++ P++P CV SF EF + +RD+ Q Sbjct: 385 MSVTPAQPQCVASFPEFSAVSVSYIRDILQ 414 >SB_45778| Best HMM Match : Exo_endo_phos (HMM E-Value=1e-10) Length = 549 Score = 27.9 bits (59), Expect = 3.4 Identities = 11/30 (36%), Positives = 19/30 (63%) Frame = +1 Query: 241 VNLVPSKPLCVESFQEFPPLGRFAVRDMRQ 330 +++ P++P CV SF EF + +RD+ Q Sbjct: 389 MSVTPAQPQCVASFPEFSAVSVSYIRDILQ 418 >SB_29742| Best HMM Match : zf-CCHC (HMM E-Value=3.4e-05) Length = 1131 Score = 27.9 bits (59), Expect = 3.4 Identities = 11/30 (36%), Positives = 19/30 (63%) Frame = +1 Query: 241 VNLVPSKPLCVESFQEFPPLGRFAVRDMRQ 330 +++ P++P CV SF EF + +RD+ Q Sbjct: 1044 MSVTPAQPQCVASFPEFSAVSVSYIRDILQ 1073 >SB_21418| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 887 Score = 27.9 bits (59), Expect = 3.4 Identities = 11/30 (36%), Positives = 19/30 (63%) Frame = +1 Query: 241 VNLVPSKPLCVESFQEFPPLGRFAVRDMRQ 330 +++ P++P CV SF EF + +RD+ Q Sbjct: 532 MSVTPAQPQCVASFPEFSAVSVSYIRDILQ 561 >SB_10446| Best HMM Match : Exo_endo_phos (HMM E-Value=6.6e-20) Length = 1285 Score = 27.9 bits (59), Expect = 3.4 Identities = 11/30 (36%), Positives = 19/30 (63%) Frame = +1 Query: 241 VNLVPSKPLCVESFQEFPPLGRFAVRDMRQ 330 +++ P++P CV SF EF + +RD+ Q Sbjct: 1111 MSVTPAQPQCVASFPEFSAVSVSYIRDILQ 1140 >SB_8311| Best HMM Match : RVT_1 (HMM E-Value=3.9e-29) Length = 605 Score = 27.9 bits (59), Expect = 3.4 Identities = 11/30 (36%), Positives = 19/30 (63%) Frame = +1 Query: 241 VNLVPSKPLCVESFQEFPPLGRFAVRDMRQ 330 +++ P++P CV SF EF + +RD+ Q Sbjct: 184 MSVTPAQPQCVASFPEFSAVSVSYIRDILQ 213 >SB_55599| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 988 Score = 27.9 bits (59), Expect = 3.4 Identities = 11/30 (36%), Positives = 19/30 (63%) Frame = +1 Query: 241 VNLVPSKPLCVESFQEFPPLGRFAVRDMRQ 330 +++ P++P CV SF EF + +RD+ Q Sbjct: 3 MSVTPAQPQCVASFPEFSAVSVSYIRDILQ 32 >SB_45671| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 270 Score = 27.9 bits (59), Expect = 3.4 Identities = 11/30 (36%), Positives = 19/30 (63%) Frame = +1 Query: 241 VNLVPSKPLCVESFQEFPPLGRFAVRDMRQ 330 +++ P++P CV SF EF + +RD+ Q Sbjct: 87 MSVTPAQPQCVASFPEFSAVSVSYIRDILQ 116 >SB_36722| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 27.9 bits (59), Expect = 3.4 Identities = 11/30 (36%), Positives = 19/30 (63%) Frame = +1 Query: 241 VNLVPSKPLCVESFQEFPPLGRFAVRDMRQ 330 +++ P++P CV SF EF + +RD+ Q Sbjct: 3 MSVTPAQPQCVASFPEFSAVSVSYIRDILQ 32 >SB_26322| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 229 Score = 27.9 bits (59), Expect = 3.4 Identities = 11/30 (36%), Positives = 19/30 (63%) Frame = +1 Query: 241 VNLVPSKPLCVESFQEFPPLGRFAVRDMRQ 330 +++ P++P CV SF EF + +RD+ Q Sbjct: 3 MSVTPAQPQCVASFPEFSAVSVSYIRDILQ 32 >SB_17484| Best HMM Match : Pox_A32 (HMM E-Value=0.025) Length = 1616 Score = 27.9 bits (59), Expect = 3.4 Identities = 16/46 (34%), Positives = 25/46 (54%), Gaps = 1/46 (2%) Frame = -3 Query: 146 QAMWAVWQSNTGVYPFDI*PG*FSTMTCAVKSA-APLGGLFFESPA 12 Q +AVW + G + + PG +ST + V+S+ A GG E+ A Sbjct: 78 QLNFAVWCATAGCFTSTLPPGGYSTSSAPVRSSIAGAGGPAMEAQA 123 >SB_8103| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1071 Score = 27.5 bits (58), Expect = 4.5 Identities = 12/31 (38%), Positives = 19/31 (61%), Gaps = 2/31 (6%) Frame = -1 Query: 319 HARRNDRGVGIPGRTPHTGAWR--EPG*QWR 233 +A++ GV + R+P G WR +PG +WR Sbjct: 657 YAKKVPSGVKLVERSPRYGEWRHKKPGYEWR 687 >SB_47012| Best HMM Match : ScdA_N (HMM E-Value=5.3) Length = 840 Score = 27.5 bits (58), Expect = 4.5 Identities = 12/31 (38%), Positives = 19/31 (61%), Gaps = 2/31 (6%) Frame = -1 Query: 319 HARRNDRGVGIPGRTPHTGAWR--EPG*QWR 233 +A++ GV + R+P G WR +PG +WR Sbjct: 659 YAKKVPSGVKLVERSPRYGEWRHKKPGYEWR 689 >SB_48433| Best HMM Match : Ion_trans (HMM E-Value=6.1e-26) Length = 1344 Score = 27.1 bits (57), Expect = 5.9 Identities = 14/39 (35%), Positives = 20/39 (51%), Gaps = 3/39 (7%) Frame = -2 Query: 363 VHSLYYTDG---DRLPHVTHGETTEGWEFLEGLHTQGLG 256 VH YT+G D++ VT GET W + G+ +G Sbjct: 734 VHIWSYTNGIDMDQVGLVTSGETVHIWSYTNGIDKDQVG 772 >SB_35253| Best HMM Match : Extensin_2 (HMM E-Value=0.078) Length = 585 Score = 27.1 bits (57), Expect = 5.9 Identities = 11/21 (52%), Positives = 13/21 (61%) Frame = -2 Query: 405 FGSFGDFATTCFLEVHSLYYT 343 FG+ F TCF +VH YYT Sbjct: 114 FGNNDFFNLTCFWDVHITYYT 134 >SB_56699| Best HMM Match : ResIII (HMM E-Value=0.053) Length = 314 Score = 27.1 bits (57), Expect = 5.9 Identities = 13/33 (39%), Positives = 18/33 (54%), Gaps = 2/33 (6%) Frame = -1 Query: 325 SCHARRNDRGVGIPGRTPHTGAWR--EPG*QWR 233 S +A+ GV + R P G WR +PG +WR Sbjct: 71 SIYAKAVPSGVKLVERNPRYGEWRHKKPGYEWR 103 >SB_45072| Best HMM Match : Kazal_2 (HMM E-Value=5.8e-06) Length = 361 Score = 27.1 bits (57), Expect = 5.9 Identities = 14/52 (26%), Positives = 22/52 (42%) Frame = +3 Query: 3 TRRCRRFEKQPTQGSCRLHSASHCAKSPRSNIKRIHTCIGLPHSPHSLQICR 158 T CR+ + P G+C S + A R + T +GL + + CR Sbjct: 46 TCNCRQKDTCPLDGNCLQTSVIYQATVTRKDNNTSETYVGLTENSFKTRFCR 97 >SB_42068| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3367 Score = 27.1 bits (57), Expect = 5.9 Identities = 12/31 (38%), Positives = 18/31 (58%), Gaps = 1/31 (3%) Frame = -3 Query: 209 GLSSVDLPVRRSTFSL-ISANLQAMWAVWQS 120 G++++ LP ST + NLQ W +WQS Sbjct: 2463 GITTIPLPSSSSTPIIDFEVNLQGEWILWQS 2493 >SB_15632| Best HMM Match : CBM_5_12 (HMM E-Value=2.9) Length = 748 Score = 26.6 bits (56), Expect = 7.8 Identities = 12/31 (38%), Positives = 16/31 (51%), Gaps = 2/31 (6%) Frame = -1 Query: 319 HARRNDRGVGIPGRTPHTGAWR--EPG*QWR 233 +A+ GV + R P G WR PG +WR Sbjct: 640 YAKEISNGVKLVERNPRYGEWRHKRPGYEWR 670 >SB_4087| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1095 Score = 26.6 bits (56), Expect = 7.8 Identities = 12/31 (38%), Positives = 16/31 (51%), Gaps = 2/31 (6%) Frame = -1 Query: 319 HARRNDRGVGIPGRTPHTGAWR--EPG*QWR 233 +A+ GV + R P G WR PG +WR Sbjct: 640 YAKEISNGVKLVERNPRYGEWRHKRPGYEWR 670 >SB_3096| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 994 Score = 26.6 bits (56), Expect = 7.8 Identities = 12/31 (38%), Positives = 16/31 (51%), Gaps = 2/31 (6%) Frame = -1 Query: 319 HARRNDRGVGIPGRTPHTGAWR--EPG*QWR 233 +A+ GV + R P G WR PG +WR Sbjct: 551 YAKAEPSGVKLVERNPRYGEWRHKRPGYEWR 581 >SB_58114| Best HMM Match : DUF1478 (HMM E-Value=3) Length = 231 Score = 26.6 bits (56), Expect = 7.8 Identities = 11/30 (36%), Positives = 19/30 (63%) Frame = +1 Query: 241 VNLVPSKPLCVESFQEFPPLGRFAVRDMRQ 330 +++ P++P CV SF EF + +RD+ Q Sbjct: 3 MSVTPAQPQCVASFPEFFAVSVSYIRDILQ 32 >SB_51131| Best HMM Match : ResIII (HMM E-Value=0.36) Length = 738 Score = 26.6 bits (56), Expect = 7.8 Identities = 13/31 (41%), Positives = 17/31 (54%), Gaps = 2/31 (6%) Frame = -1 Query: 319 HARRNDRGVGIPGRTPHTGAWR--EPG*QWR 233 +A+ GV I R P G WR +PG +WR Sbjct: 447 YAKAVPSGVKIVERNPRYGEWRHKKPGYEWR 477 >SB_26806| Best HMM Match : Annexin (HMM E-Value=0) Length = 829 Score = 26.6 bits (56), Expect = 7.8 Identities = 15/38 (39%), Positives = 21/38 (55%), Gaps = 1/38 (2%) Frame = +1 Query: 121 DCHTAHIACKFAE-IKEKVDRRTGKSTEDNPKSIKSGD 231 D T + A K + IKE+ ++ G S ED+ K SGD Sbjct: 77 DARTLYFAMKNIDSIKEEYQKKYGCSLEDDVKEETSGD 114 >SB_21811| Best HMM Match : DNA_pol_B_2 (HMM E-Value=3.7e-06) Length = 925 Score = 26.6 bits (56), Expect = 7.8 Identities = 8/21 (38%), Positives = 12/21 (57%) Frame = -2 Query: 75 HNDLRCEVCSSPGWVVFRISC 13 H ++C VC GW + R+ C Sbjct: 172 HRRVKCSVCKKVGWSMDRLVC 192 >SB_20319| Best HMM Match : IncA (HMM E-Value=0.2) Length = 566 Score = 26.6 bits (56), Expect = 7.8 Identities = 13/41 (31%), Positives = 19/41 (46%) Frame = +3 Query: 48 CRLHSASHCAKSPRSNIKRIHTCIGLPHSPHSLQICRNQRE 170 C++ +A H SP + IH G H+ +I QRE Sbjct: 345 CKIRAAEHLVASPSAPDGEIHIVEGTAHTYRLQKISAIQRE 385 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.315 0.132 0.386 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,728,192 Number of Sequences: 59808 Number of extensions: 371003 Number of successful extensions: 1375 Number of sequences better than 10.0: 40 Number of HSP's better than 10.0 without gapping: 1288 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1371 length of database: 16,821,457 effective HSP length: 75 effective length of database: 12,335,857 effective search space used: 740151420 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.6 bits)
- SilkBase 1999-2023 -