BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0001_A20 (395 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292382-1|CAL23194.2| 670|Tribolium castaneum gustatory recept... 24 0.63 AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ... 22 2.5 AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ... 22 2.5 AJ876407-1|CAI45288.1| 590|Tribolium castaneum phosphatase prot... 22 2.5 DQ414246-1|ABD63008.1| 126|Tribolium castaneum odd-skipped prot... 21 5.9 AF225975-1|AAF74117.1| 256|Tribolium castaneum unknown protein. 20 7.7 >AM292382-1|CAL23194.2| 670|Tribolium castaneum gustatory receptor candidate 61 protein. Length = 670 Score = 23.8 bits (49), Expect = 0.63 Identities = 8/38 (21%), Positives = 20/38 (52%) Frame = +2 Query: 125 KTYKNVADKSFSDIILFCLDIQLTQDSDLSTKICLTCH 238 KT N+ + ++ ++ D + ++ + + IC+ CH Sbjct: 202 KTINNILENLWAKKLIVVKDKKKSRSDEQTIDICMRCH 239 >AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase protein. Length = 1464 Score = 21.8 bits (44), Expect = 2.5 Identities = 7/18 (38%), Positives = 12/18 (66%) Frame = -1 Query: 83 LCTSPTFSITIQRLKARD 30 LC+ P +T+ L++RD Sbjct: 1323 LCSKPIDEMTVDELRSRD 1340 >AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2 protein. Length = 1464 Score = 21.8 bits (44), Expect = 2.5 Identities = 7/18 (38%), Positives = 12/18 (66%) Frame = -1 Query: 83 LCTSPTFSITIQRLKARD 30 LC+ P +T+ L++RD Sbjct: 1323 LCSKPIDEMTVDELRSRD 1340 >AJ876407-1|CAI45288.1| 590|Tribolium castaneum phosphatase protein. Length = 590 Score = 21.8 bits (44), Expect = 2.5 Identities = 6/22 (27%), Positives = 13/22 (59%) Frame = -3 Query: 255 NAMVFLWHVRHIFVLKSESCVN 190 NA+ W + H+F ++ + +N Sbjct: 446 NALCMTWLMDHVFAIREAATLN 467 >DQ414246-1|ABD63008.1| 126|Tribolium castaneum odd-skipped protein. Length = 126 Score = 20.6 bits (41), Expect = 5.9 Identities = 6/20 (30%), Positives = 13/20 (65%) Frame = -1 Query: 164 YQKNFYQPHFYKFLHHKYLF 105 Y +Y P++Y++L + L+ Sbjct: 33 YCDPWYNPYYYQYLQNAALY 52 >AF225975-1|AAF74117.1| 256|Tribolium castaneum unknown protein. Length = 256 Score = 20.2 bits (40), Expect = 7.7 Identities = 6/16 (37%), Positives = 12/16 (75%) Frame = -3 Query: 93 LRHTLHQSNIFNNHSK 46 L H +HQ+ I++N+ + Sbjct: 42 LHHPIHQTVIYHNNPR 57 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 90,460 Number of Sequences: 336 Number of extensions: 2005 Number of successful extensions: 8 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 122,585 effective HSP length: 51 effective length of database: 105,449 effective search space used: 8435920 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 39 (20.8 bits)
- SilkBase 1999-2023 -