BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0001_A20 (395 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY725820-1|AAU50568.1| 593|Anopheles gambiae fruitless female-s... 25 1.0 EF426244-1|ABO26487.1| 64|Anopheles gambiae unknown protein. 23 4.1 EF426243-1|ABO26486.1| 64|Anopheles gambiae unknown protein. 23 4.1 EF426242-1|ABO26485.1| 64|Anopheles gambiae unknown protein. 23 4.1 EF426241-1|ABO26484.1| 64|Anopheles gambiae unknown protein. 23 4.1 EF426239-1|ABO26482.1| 64|Anopheles gambiae unknown protein. 23 4.1 EF426238-1|ABO26481.1| 64|Anopheles gambiae unknown protein. 23 4.1 EF426237-1|ABO26480.1| 64|Anopheles gambiae unknown protein. 23 4.1 EF426236-1|ABO26479.1| 64|Anopheles gambiae unknown protein. 23 4.1 EF426235-1|ABO26478.1| 64|Anopheles gambiae unknown protein. 23 4.1 EF426234-1|ABO26477.1| 64|Anopheles gambiae unknown protein. 23 4.1 EF426233-1|ABO26476.1| 64|Anopheles gambiae unknown protein. 23 4.1 EF426232-1|ABO26475.1| 64|Anopheles gambiae unknown protein. 23 4.1 EF426231-1|ABO26474.1| 64|Anopheles gambiae unknown protein. 23 4.1 EF426230-1|ABO26473.1| 64|Anopheles gambiae unknown protein. 23 4.1 EF426229-1|ABO26472.1| 64|Anopheles gambiae unknown protein. 23 4.1 EF426228-1|ABO26471.1| 64|Anopheles gambiae unknown protein. 23 4.1 EF426227-1|ABO26470.1| 64|Anopheles gambiae unknown protein. 23 4.1 EF426226-1|ABO26469.1| 64|Anopheles gambiae unknown protein. 23 4.1 EF426225-1|ABO26468.1| 64|Anopheles gambiae unknown protein. 23 4.1 AY187041-1|AAO39755.1| 272|Anopheles gambiae putative antennal ... 23 5.4 >AY725820-1|AAU50568.1| 593|Anopheles gambiae fruitless female-specific zinc-fingerC isoform protein. Length = 593 Score = 25.0 bits (52), Expect = 1.0 Identities = 15/40 (37%), Positives = 22/40 (55%), Gaps = 1/40 (2%) Frame = +2 Query: 278 LKNDIYAKSMRATYKNEPESH-NTVRNIKIEKITISDNAE 394 LK +YA M A+ EP +H N +R+ I I+ NA+ Sbjct: 390 LKMPLYADEMSASIGLEPHAHLNHLRHKSKHPIPINMNAD 429 >EF426244-1|ABO26487.1| 64|Anopheles gambiae unknown protein. Length = 64 Score = 23.0 bits (47), Expect = 4.1 Identities = 7/18 (38%), Positives = 12/18 (66%) Frame = -1 Query: 338 ATLAHFYMWLS*IWHIYH 285 A +A +MW +WH++H Sbjct: 18 AQVAGGFMWWWVLWHLFH 35 >EF426243-1|ABO26486.1| 64|Anopheles gambiae unknown protein. Length = 64 Score = 23.0 bits (47), Expect = 4.1 Identities = 7/18 (38%), Positives = 12/18 (66%) Frame = -1 Query: 338 ATLAHFYMWLS*IWHIYH 285 A +A +MW +WH++H Sbjct: 18 AQVAGGFMWWWVLWHLFH 35 >EF426242-1|ABO26485.1| 64|Anopheles gambiae unknown protein. Length = 64 Score = 23.0 bits (47), Expect = 4.1 Identities = 7/18 (38%), Positives = 12/18 (66%) Frame = -1 Query: 338 ATLAHFYMWLS*IWHIYH 285 A +A +MW +WH++H Sbjct: 18 AQVAGGFMWWWVLWHLFH 35 >EF426241-1|ABO26484.1| 64|Anopheles gambiae unknown protein. Length = 64 Score = 23.0 bits (47), Expect = 4.1 Identities = 7/18 (38%), Positives = 12/18 (66%) Frame = -1 Query: 338 ATLAHFYMWLS*IWHIYH 285 A +A +MW +WH++H Sbjct: 18 AQVAGGFMWWWVLWHLFH 35 >EF426239-1|ABO26482.1| 64|Anopheles gambiae unknown protein. Length = 64 Score = 23.0 bits (47), Expect = 4.1 Identities = 7/18 (38%), Positives = 12/18 (66%) Frame = -1 Query: 338 ATLAHFYMWLS*IWHIYH 285 A +A +MW +WH++H Sbjct: 18 AQVAGGFMWWWVLWHLFH 35 >EF426238-1|ABO26481.1| 64|Anopheles gambiae unknown protein. Length = 64 Score = 23.0 bits (47), Expect = 4.1 Identities = 7/18 (38%), Positives = 12/18 (66%) Frame = -1 Query: 338 ATLAHFYMWLS*IWHIYH 285 A +A +MW +WH++H Sbjct: 18 AQVAGGFMWWWVLWHLFH 35 >EF426237-1|ABO26480.1| 64|Anopheles gambiae unknown protein. Length = 64 Score = 23.0 bits (47), Expect = 4.1 Identities = 7/18 (38%), Positives = 12/18 (66%) Frame = -1 Query: 338 ATLAHFYMWLS*IWHIYH 285 A +A +MW +WH++H Sbjct: 18 AQVAGGFMWWWVLWHLFH 35 >EF426236-1|ABO26479.1| 64|Anopheles gambiae unknown protein. Length = 64 Score = 23.0 bits (47), Expect = 4.1 Identities = 7/18 (38%), Positives = 12/18 (66%) Frame = -1 Query: 338 ATLAHFYMWLS*IWHIYH 285 A +A +MW +WH++H Sbjct: 18 AQVAGGFMWWWVLWHLFH 35 >EF426235-1|ABO26478.1| 64|Anopheles gambiae unknown protein. Length = 64 Score = 23.0 bits (47), Expect = 4.1 Identities = 7/18 (38%), Positives = 12/18 (66%) Frame = -1 Query: 338 ATLAHFYMWLS*IWHIYH 285 A +A +MW +WH++H Sbjct: 18 AQVAGGFMWWWVLWHLFH 35 >EF426234-1|ABO26477.1| 64|Anopheles gambiae unknown protein. Length = 64 Score = 23.0 bits (47), Expect = 4.1 Identities = 7/18 (38%), Positives = 12/18 (66%) Frame = -1 Query: 338 ATLAHFYMWLS*IWHIYH 285 A +A +MW +WH++H Sbjct: 18 AQVAGGFMWWWVLWHLFH 35 >EF426233-1|ABO26476.1| 64|Anopheles gambiae unknown protein. Length = 64 Score = 23.0 bits (47), Expect = 4.1 Identities = 7/18 (38%), Positives = 12/18 (66%) Frame = -1 Query: 338 ATLAHFYMWLS*IWHIYH 285 A +A +MW +WH++H Sbjct: 18 AQVAGGFMWWWVLWHLFH 35 >EF426232-1|ABO26475.1| 64|Anopheles gambiae unknown protein. Length = 64 Score = 23.0 bits (47), Expect = 4.1 Identities = 7/18 (38%), Positives = 12/18 (66%) Frame = -1 Query: 338 ATLAHFYMWLS*IWHIYH 285 A +A +MW +WH++H Sbjct: 18 AQVAGGFMWWWVLWHLFH 35 >EF426231-1|ABO26474.1| 64|Anopheles gambiae unknown protein. Length = 64 Score = 23.0 bits (47), Expect = 4.1 Identities = 7/18 (38%), Positives = 12/18 (66%) Frame = -1 Query: 338 ATLAHFYMWLS*IWHIYH 285 A +A +MW +WH++H Sbjct: 18 AQVAGGFMWWWVLWHLFH 35 >EF426230-1|ABO26473.1| 64|Anopheles gambiae unknown protein. Length = 64 Score = 23.0 bits (47), Expect = 4.1 Identities = 7/18 (38%), Positives = 12/18 (66%) Frame = -1 Query: 338 ATLAHFYMWLS*IWHIYH 285 A +A +MW +WH++H Sbjct: 18 AQVAGGFMWWWVLWHLFH 35 >EF426229-1|ABO26472.1| 64|Anopheles gambiae unknown protein. Length = 64 Score = 23.0 bits (47), Expect = 4.1 Identities = 7/18 (38%), Positives = 12/18 (66%) Frame = -1 Query: 338 ATLAHFYMWLS*IWHIYH 285 A +A +MW +WH++H Sbjct: 18 AQVAGGFMWWWVLWHLFH 35 >EF426228-1|ABO26471.1| 64|Anopheles gambiae unknown protein. Length = 64 Score = 23.0 bits (47), Expect = 4.1 Identities = 7/18 (38%), Positives = 12/18 (66%) Frame = -1 Query: 338 ATLAHFYMWLS*IWHIYH 285 A +A +MW +WH++H Sbjct: 18 AQVAGGFMWWWVLWHLFH 35 >EF426227-1|ABO26470.1| 64|Anopheles gambiae unknown protein. Length = 64 Score = 23.0 bits (47), Expect = 4.1 Identities = 7/18 (38%), Positives = 12/18 (66%) Frame = -1 Query: 338 ATLAHFYMWLS*IWHIYH 285 A +A +MW +WH++H Sbjct: 18 AQVAGGFMWWWVLWHLFH 35 >EF426226-1|ABO26469.1| 64|Anopheles gambiae unknown protein. Length = 64 Score = 23.0 bits (47), Expect = 4.1 Identities = 7/18 (38%), Positives = 12/18 (66%) Frame = -1 Query: 338 ATLAHFYMWLS*IWHIYH 285 A +A +MW +WH++H Sbjct: 18 AQVAGGFMWWWVLWHLFH 35 >EF426225-1|ABO26468.1| 64|Anopheles gambiae unknown protein. Length = 64 Score = 23.0 bits (47), Expect = 4.1 Identities = 7/18 (38%), Positives = 12/18 (66%) Frame = -1 Query: 338 ATLAHFYMWLS*IWHIYH 285 A +A +MW +WH++H Sbjct: 18 AQVAGGFMWWWVLWHLFH 35 >AY187041-1|AAO39755.1| 272|Anopheles gambiae putative antennal carrier protein TOL-1 protein. Length = 272 Score = 22.6 bits (46), Expect = 5.4 Identities = 7/9 (77%), Positives = 8/9 (88%) Frame = +3 Query: 45 PLNGY*KCW 71 PLNG+ KCW Sbjct: 154 PLNGHGKCW 162 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 367,601 Number of Sequences: 2352 Number of extensions: 7015 Number of successful extensions: 24 Number of sequences better than 10.0: 21 Number of HSP's better than 10.0 without gapping: 24 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 24 length of database: 563,979 effective HSP length: 58 effective length of database: 427,563 effective search space used: 31212099 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -