BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0001_A20 (395 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ435324-1|ABD92639.1| 152|Apis mellifera OBP3 protein. 24 0.73 AY313893-1|AAQ82184.1| 437|Apis mellifera major royal jelly pro... 21 3.9 >DQ435324-1|ABD92639.1| 152|Apis mellifera OBP3 protein. Length = 152 Score = 23.8 bits (49), Expect = 0.73 Identities = 13/31 (41%), Positives = 18/31 (58%), Gaps = 3/31 (9%) Frame = -1 Query: 281 LVLLF*ICRMLWFFYGMSDIFLCL---NLNL 198 ++LLF +C + + DI LCL NLNL Sbjct: 5 VILLFTLCIVSYMMVRCDDITLCLKQENLNL 35 >AY313893-1|AAQ82184.1| 437|Apis mellifera major royal jelly protein MRJP6 protein. Length = 437 Score = 21.4 bits (43), Expect = 3.9 Identities = 12/28 (42%), Positives = 14/28 (50%) Frame = +2 Query: 200 DSDLSTKICLTCHKKTIAFYKFKTKALK 283 DS L I L C K +AF +K LK Sbjct: 143 DSGLINNIQLMCSPKLLAFDLNTSKLLK 170 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 101,741 Number of Sequences: 438 Number of extensions: 2038 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 146,343 effective HSP length: 52 effective length of database: 123,567 effective search space used: 9761793 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -