BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0001_A19 (390 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ438610-1|CAD27473.1| 838|Anopheles gambiae putative microtubu... 27 0.32 AJ438610-3|CAD27475.1| 190|Anopheles gambiae putative RHO small... 23 3.0 AY705401-1|AAU12510.1| 490|Anopheles gambiae nicotinic acetylch... 23 5.2 AY705400-1|AAU12509.1| 490|Anopheles gambiae nicotinic acetylch... 23 5.2 AF444783-1|AAL37904.1| 1356|Anopheles gambiae Trex protein. 23 5.2 AY745210-1|AAU93477.1| 86|Anopheles gambiae cytochrome P450 pr... 22 6.9 EF990672-1|ABS30733.1| 466|Anopheles gambiae voltage-gated calc... 22 9.1 AY341161-1|AAR13725.1| 159|Anopheles gambiae CED6 protein. 22 9.1 AF364130-1|AAL35506.1| 417|Anopheles gambiae putative odorant r... 22 9.1 AB090822-2|BAC57920.1| 1173|Anopheles gambiae reverse transcript... 22 9.1 >AJ438610-1|CAD27473.1| 838|Anopheles gambiae putative microtubule binding protein protein. Length = 838 Score = 26.6 bits (56), Expect = 0.32 Identities = 14/29 (48%), Positives = 19/29 (65%), Gaps = 2/29 (6%) Frame = -3 Query: 112 APVLSAQLITAPTGRPSE--MRNFAPAEP 32 APV+ + ++TAP RPS+ FAP EP Sbjct: 91 APVVPSSVVTAPPARPSQPPTTRFAP-EP 118 >AJ438610-3|CAD27475.1| 190|Anopheles gambiae putative RHO small GTPase protein. Length = 190 Score = 23.4 bits (48), Expect = 3.0 Identities = 7/11 (63%), Positives = 8/11 (72%) Frame = -2 Query: 278 SKWFPLPDHHC 246 SKW+P HHC Sbjct: 98 SKWYPEIKHHC 108 >AY705401-1|AAU12510.1| 490|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 6 protein. Length = 490 Score = 22.6 bits (46), Expect = 5.2 Identities = 6/9 (66%), Positives = 6/9 (66%) Frame = -2 Query: 272 WFPLPDHHC 246 WFP D HC Sbjct: 154 WFPFDDQHC 162 >AY705400-1|AAU12509.1| 490|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 6 protein. Length = 490 Score = 22.6 bits (46), Expect = 5.2 Identities = 6/9 (66%), Positives = 6/9 (66%) Frame = -2 Query: 272 WFPLPDHHC 246 WFP D HC Sbjct: 154 WFPFDDQHC 162 >AF444783-1|AAL37904.1| 1356|Anopheles gambiae Trex protein. Length = 1356 Score = 22.6 bits (46), Expect = 5.2 Identities = 9/30 (30%), Positives = 15/30 (50%) Frame = -3 Query: 112 APVLSAQLITAPTGRPSEMRNFAPAEPPRP 23 A +S+ P +P++ +PAE P P Sbjct: 951 ASYVSSNATVVPATQPADASQASPAEEPLP 980 Score = 21.8 bits (44), Expect = 9.1 Identities = 11/36 (30%), Positives = 17/36 (47%) Frame = -2 Query: 170 W*PVQTTLDTLYGNHIQIFCSCIICTIDHSSHWETQ 63 W + T GN+ +I + TID SS+ T+ Sbjct: 573 WLDIHANKITELGNYFEIESQLALSTIDASSNQLTE 608 >AY745210-1|AAU93477.1| 86|Anopheles gambiae cytochrome P450 protein. Length = 86 Score = 22.2 bits (45), Expect = 6.9 Identities = 16/59 (27%), Positives = 27/59 (45%), Gaps = 1/59 (1%) Frame = +1 Query: 4 RGKCLKEDVVVPRERSSASRWVSQW-EL*SIVQIIQEQKICM*LPYKVSRVV*TGYQLL 177 R CL ED +R RW+ Q E ++V E + LP+ + R + G +++ Sbjct: 18 RVACLSEDNFQQADRFLPDRWLEQRDENDNVVNKRAEPGASVVLPFGIGRRMCPGQKVI 76 >EF990672-1|ABS30733.1| 466|Anopheles gambiae voltage-gated calcium channel beta subunitprotein. Length = 466 Score = 21.8 bits (44), Expect = 9.1 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +2 Query: 317 GGHREQQGGDERLGY 361 GGHRE +G LGY Sbjct: 14 GGHRESRGIGLGLGY 28 >AY341161-1|AAR13725.1| 159|Anopheles gambiae CED6 protein. Length = 159 Score = 21.8 bits (44), Expect = 9.1 Identities = 11/39 (28%), Positives = 15/39 (38%) Frame = +3 Query: 72 PVGAVINCADNTGAKNLYVIAVQGIKGRLNRLPAAGSGD 188 P+ + CAD G K + + G A SGD Sbjct: 67 PLHKISYCADEKGVKKFFSFIAKTGTGATPTSSIASSGD 105 >AF364130-1|AAL35506.1| 417|Anopheles gambiae putative odorant receptor Or1 protein. Length = 417 Score = 21.8 bits (44), Expect = 9.1 Identities = 7/16 (43%), Positives = 9/16 (56%) Frame = -2 Query: 296 EHPVPPSKWFPLPDHH 249 E +P WFP+ HH Sbjct: 161 ERRLPVPAWFPVDYHH 176 >AB090822-2|BAC57920.1| 1173|Anopheles gambiae reverse transcriptase protein. Length = 1173 Score = 21.8 bits (44), Expect = 9.1 Identities = 7/20 (35%), Positives = 10/20 (50%) Frame = -2 Query: 329 HDDPRIILEIYEHPVPPSKW 270 H D ++ E+Y HP W Sbjct: 27 HADVILVSELYRHPPNNGNW 46 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 465,515 Number of Sequences: 2352 Number of extensions: 10407 Number of successful extensions: 23 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 22 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 23 length of database: 563,979 effective HSP length: 58 effective length of database: 427,563 effective search space used: 30356973 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -