BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0001_A15 (395 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_4350| Best HMM Match : L15 (HMM E-Value=3.9e-10) 94 4e-20 SB_45977| Best HMM Match : MBT (HMM E-Value=0) 29 1.8 SB_29637| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 4.2 SB_59184| Best HMM Match : Glyco_transf_17 (HMM E-Value=1.6e-11) 27 5.5 SB_13394| Best HMM Match : Chordopox_A13L (HMM E-Value=3.2) 27 5.5 SB_50164| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.3 SB_44132| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.3 SB_7383| Best HMM Match : SapA (HMM E-Value=1.2e-13) 27 7.3 SB_22205| Best HMM Match : DUF805 (HMM E-Value=7.7) 27 7.3 SB_28690| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 9.6 >SB_4350| Best HMM Match : L15 (HMM E-Value=3.9e-10) Length = 173 Score = 93.9 bits (223), Expect = 4e-20 Identities = 43/84 (51%), Positives = 56/84 (66%) Frame = +3 Query: 144 RINMDKYHPGYFGKLGMRNYHMRRNKDFCPVLNLDKLWTLVSEQARLKYASATDGKVPVI 323 R + + HPGYFGK+GMR++H+ RN P +NLDK+W+LVSEQ R Y + DG VPVI Sbjct: 67 RGSYEAIHPGYFGKVGMRHFHLTRNAYHKPSINLDKVWSLVSEQTRQNYKNKKDGPVPVI 126 Query: 324 NIVEAXXXXXXXXXXXPKQPVIVK 395 ++V+A PKQPVIVK Sbjct: 127 DVVKAGYYKVLGKGLLPKQPVIVK 150 >SB_45977| Best HMM Match : MBT (HMM E-Value=0) Length = 1198 Score = 28.7 bits (61), Expect = 1.8 Identities = 13/31 (41%), Positives = 16/31 (51%), Gaps = 2/31 (6%) Frame = -3 Query: 165 GTCPC*FCDGAHH--QHYHVHQDAYGACRYD 79 G CP CDG+ H H+ HQ + G R D Sbjct: 939 GVCPTPGCDGSGHVSGHWRTHQSSAGCPRND 969 >SB_29637| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 234 Score = 27.5 bits (58), Expect = 4.2 Identities = 8/18 (44%), Positives = 12/18 (66%) Frame = -3 Query: 132 HHQHYHVHQDAYGACRYD 79 HHQH+H+ D+ C+ D Sbjct: 132 HHQHHHIKTDSQERCQID 149 >SB_59184| Best HMM Match : Glyco_transf_17 (HMM E-Value=1.6e-11) Length = 268 Score = 27.1 bits (57), Expect = 5.5 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +3 Query: 156 DKYHPGYFGKLGMRNYHMRRNKDFCPVLNLDKL 254 D Y Y GK G+ N RN D V +LD++ Sbjct: 170 DAYLRSYLGKHGVANIRNLRNDDVIIVCDLDEI 202 >SB_13394| Best HMM Match : Chordopox_A13L (HMM E-Value=3.2) Length = 694 Score = 27.1 bits (57), Expect = 5.5 Identities = 8/21 (38%), Positives = 12/21 (57%) Frame = -3 Query: 132 HHQHYHVHQDAYGACRYDHDH 70 HHQH+H H + + H+H Sbjct: 213 HHQHHHHHHHQHNHHHHHHNH 233 >SB_50164| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1780 Score = 26.6 bits (56), Expect = 7.3 Identities = 10/25 (40%), Positives = 15/25 (60%), Gaps = 2/25 (8%) Frame = +2 Query: 143 QNQHGQVPPWVLWQTW--YEKLPHE 211 +N +G +PP W+ W YE P+E Sbjct: 97 RNSYGSLPPRARWRRWGEYETQPNE 121 >SB_44132| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 26.6 bits (56), Expect = 7.3 Identities = 8/21 (38%), Positives = 12/21 (57%) Frame = -3 Query: 132 HHQHYHVHQDAYGACRYDHDH 70 +H H+H HQ Y +H+H Sbjct: 30 YHHHHHYHQQQYRKHHNNHNH 50 >SB_7383| Best HMM Match : SapA (HMM E-Value=1.2e-13) Length = 492 Score = 26.6 bits (56), Expect = 7.3 Identities = 15/38 (39%), Positives = 16/38 (42%), Gaps = 1/38 (2%) Frame = -3 Query: 177 STQGGTCPC*F-CDGAHHQHYHVHQDAYGACRYDHDHG 67 S GG C CDG H H H H G Y D+G Sbjct: 108 SNSGGDVDCDDDCDGRSHSHRHAHGGGPG---YGGDYG 142 >SB_22205| Best HMM Match : DUF805 (HMM E-Value=7.7) Length = 347 Score = 26.6 bits (56), Expect = 7.3 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +2 Query: 26 PPPRRRQEVERTREPWSWSYRQAP 97 PPP R + PW SYRQ P Sbjct: 82 PPPHRDKTAVICPYPWDASYRQLP 105 >SB_28690| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2179 Score = 26.2 bits (55), Expect = 9.6 Identities = 8/15 (53%), Positives = 10/15 (66%) Frame = -3 Query: 147 FCDGAHHQHYHVHQD 103 +C HH H+H HQD Sbjct: 1254 WCHHHHHHHHHHHQD 1268 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,907,969 Number of Sequences: 59808 Number of extensions: 243615 Number of successful extensions: 821 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 694 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 809 length of database: 16,821,457 effective HSP length: 75 effective length of database: 12,335,857 effective search space used: 690807992 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -