BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0001_A14 (570 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_15432| Best HMM Match : Ribosomal_L10 (HMM E-Value=3.1e-37) 227 5e-60 SB_37596| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.7 >SB_15432| Best HMM Match : Ribosomal_L10 (HMM E-Value=3.1e-37) Length = 261 Score = 227 bits (555), Expect = 5e-60 Identities = 106/143 (74%), Positives = 122/143 (85%) Frame = +1 Query: 142 QLLDEYPKCFIVGADNVGSQQMQQIRISLRGHSIVLMGKNTMMRKAIKDHLETNPALEKL 321 Q LDEYPK F+VG DNVGS+QMQ IR SLRG VLMGKNTM+RKAI+ HLE NP LEKL Sbjct: 1 QYLDEYPKLFLVGVDNVGSKQMQTIRQSLRGQGEVLMGKNTMIRKAIRGHLENNPDLEKL 60 Query: 322 LPHIKGNVGFVFTRGDLVDVRDKLLENKVQAPARPGAIAPLSVVIPAHNTGLGPEKTSFF 501 LPHIKGN+GFVFT+ DL DVR ++ENKV APA+ G IAP+ V +PA NTGLGPEKTSFF Sbjct: 61 LPHIKGNIGFVFTKEDLADVRKIIMENKVAAPAKAGVIAPIDVFVPAGNTGLGPEKTSFF 120 Query: 502 QALSIPTKISKGTIEIINDVHIL 570 QAL+IPTKI++GTIEIINDVH++ Sbjct: 121 QALAIPTKIARGTIEIINDVHLI 143 >SB_37596| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 408 Score = 28.3 bits (60), Expect = 4.7 Identities = 12/39 (30%), Positives = 21/39 (53%) Frame = +3 Query: 213 DPYFIAWSQHCAHGQKHHDEESHQGPS*NKSSSRKTASS 329 D Y QH H Q HD ++H+ + +++++R A S Sbjct: 144 DQYTTQPDQHMTHNQIDHDTQTHRPTTRSQTNTRHAARS 182 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,300,091 Number of Sequences: 59808 Number of extensions: 426635 Number of successful extensions: 1135 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1020 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1134 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1349364063 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -