BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0001_A13 (382 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY496420-1|AAS80137.1| 447|Anopheles gambiae bacteria responsiv... 102 5e-24 AY496421-1|AAS80138.1| 439|Anopheles gambiae bacteria responsiv... 89 4e-20 AF008575-1|AAB87764.1| 525|Anopheles gambiae chitinase protein. 40 4e-05 AJ439353-7|CAD27929.1| 555|Anopheles gambiae putative glycerol ... 24 1.6 AF119382-1|AAD27585.1| 394|Anopheles gambiae caudal protein hom... 23 3.8 DQ396551-1|ABD60146.1| 354|Anopheles gambiae adipokinetic hormo... 23 5.0 AY298745-1|AAQ63187.1| 354|Anopheles gambiae G-protein coupled ... 23 5.0 AJ973471-1|CAJ01518.1| 122|Anopheles gambiae hypothetical prote... 23 5.0 AJ697731-1|CAG26924.1| 122|Anopheles gambiae putative chemosens... 23 5.0 AJ697730-1|CAG26923.1| 122|Anopheles gambiae putative chemosens... 23 5.0 AY752908-1|AAV30082.1| 103|Anopheles gambiae peroxidase 13B pro... 22 6.6 AF515521-1|AAM61888.1| 233|Anopheles gambiae glutathione S-tran... 22 6.6 AY578801-1|AAT07306.1| 506|Anopheles gambiae dSmad2 protein. 22 8.7 AJ973474-1|CAJ01521.1| 191|Anopheles gambiae hypothetical prote... 22 8.7 AJ697734-1|CAG26927.1| 191|Anopheles gambiae putative chemosens... 22 8.7 AJ439353-10|CAD27932.1| 3325|Anopheles gambiae F25C8.3 protein p... 22 8.7 >AY496420-1|AAS80137.1| 447|Anopheles gambiae bacteria responsive protein 1 protein. Length = 447 Score = 102 bits (244), Expect = 5e-24 Identities = 43/83 (51%), Positives = 64/83 (77%) Frame = +2 Query: 134 KVLCYYDSKSYIRESQARMLPTDLEPALSFCTHLLYKSAGIQADTYKMVSLNENLDIDRA 313 KVLCYYD + +RE ++ +D+E AL FCTHL+Y AG+ A+TY++ SLNE+LD+D Sbjct: 32 KVLCYYDGSNALREGLGKVTVSDIELALPFCTHLMYGYAGVNAETYRLRSLNEDLDLDSG 91 Query: 314 HANYRAITNLKRQFPQLRVFLTV 382 +++RA+T LKR++P L+VFL+V Sbjct: 92 KSHFRAVTTLKRRYPGLKVFLSV 114 >AY496421-1|AAS80138.1| 439|Anopheles gambiae bacteria responsive protein 2 protein. Length = 439 Score = 89.4 bits (212), Expect = 4e-20 Identities = 40/92 (43%), Positives = 56/92 (60%) Frame = +2 Query: 101 TNHPASPSSQSKVLCYYDSKSYIRESQARMLPTDLEPALSFCTHLLYKSAGIQADTYKMV 280 T+ SKVLCYYD+ +++ E ++ D++ AL FCTHL+Y AGI +T K V Sbjct: 16 TSQYVQSQQPSKVLCYYDAANFLIEGLGKVSLADIDAALPFCTHLVYGYAGIDVETNKAV 75 Query: 281 SLNENLDIDRAHANYRAITNLKRQFPQLRVFL 376 S NLD+D NYR +T LK ++P L+V L Sbjct: 76 SRQPNLDLDTGKGNYRTVTQLKSKYPSLKVLL 107 >AF008575-1|AAB87764.1| 525|Anopheles gambiae chitinase protein. Length = 525 Score = 39.5 bits (88), Expect = 4e-05 Identities = 24/93 (25%), Positives = 43/93 (46%), Gaps = 1/93 (1%) Frame = +2 Query: 107 HPASPSSQSKVLCYYDSKSYIRESQARMLPTDLEPALSFCTHLLYKSAGIQAD-TYKMVS 283 H A+ + KV+CY + + R R ++P+L CTHL+Y GI D T +++ Sbjct: 23 HKAASAEGKKVVCYVGTWAVYRPGNGRYDIEHIDPSL--CTHLMYGFFGINEDATVRIID 80 Query: 284 LNENLDIDRAHANYRAITNLKRQFPQLRVFLTV 382 +L+ + + + LK P L+ + Sbjct: 81 PYLDLEENWGRGHIKRFVGLKNVGPGLKTLAAI 113 >AJ439353-7|CAD27929.1| 555|Anopheles gambiae putative glycerol kinase protein. Length = 555 Score = 24.2 bits (50), Expect = 1.6 Identities = 11/29 (37%), Positives = 14/29 (48%) Frame = +3 Query: 105 TTQHHLVAKAKSSATMTARAISENLKHVC 191 TT+HH V A + R I E +K C Sbjct: 386 TTKHHFVRAALEAVCFQTRDIIEAMKKDC 414 >AF119382-1|AAD27585.1| 394|Anopheles gambiae caudal protein homolog protein. Length = 394 Score = 23.0 bits (47), Expect = 3.8 Identities = 10/29 (34%), Positives = 18/29 (62%) Frame = +3 Query: 93 LRLPTTQHHLVAKAKSSATMTARAISENL 179 L +PT+QHH + +A +A ++ S +L Sbjct: 363 LGVPTSQHHQLNQAAVAAAAASQVPSTSL 391 >DQ396551-1|ABD60146.1| 354|Anopheles gambiae adipokinetic hormone receptor protein. Length = 354 Score = 22.6 bits (46), Expect = 5.0 Identities = 9/38 (23%), Positives = 19/38 (50%) Frame = -2 Query: 309 RSMSKFSLSETILYVSAWMPADLYSRWVQNERAGSKSV 196 R + ++ I++V W P + S W ++ +K+V Sbjct: 264 RKTLRMTIMIVIVFVVCWTPYYVMSLWYWLDKESTKNV 301 >AY298745-1|AAQ63187.1| 354|Anopheles gambiae G-protein coupled receptor protein. Length = 354 Score = 22.6 bits (46), Expect = 5.0 Identities = 9/38 (23%), Positives = 19/38 (50%) Frame = -2 Query: 309 RSMSKFSLSETILYVSAWMPADLYSRWVQNERAGSKSV 196 R + ++ I++V W P + S W ++ +K+V Sbjct: 264 RKTLRMTIMIVIVFVVCWTPYYVMSLWYWLDKESAKNV 301 >AJ973471-1|CAJ01518.1| 122|Anopheles gambiae hypothetical protein protein. Length = 122 Score = 22.6 bits (46), Expect = 5.0 Identities = 9/29 (31%), Positives = 15/29 (51%) Frame = +2 Query: 254 IQADTYKMVSLNENLDIDRAHANYRAITN 340 + A K +N+D+DR +N R + N Sbjct: 15 VLASAQKYTDKFDNIDVDRVLSNDRILNN 43 >AJ697731-1|CAG26924.1| 122|Anopheles gambiae putative chemosensory protein CSP2 protein. Length = 122 Score = 22.6 bits (46), Expect = 5.0 Identities = 9/29 (31%), Positives = 15/29 (51%) Frame = +2 Query: 254 IQADTYKMVSLNENLDIDRAHANYRAITN 340 + A K +N+D+DR +N R + N Sbjct: 15 VLASAQKYTDKFDNIDVDRVLSNDRILNN 43 >AJ697730-1|CAG26923.1| 122|Anopheles gambiae putative chemosensory protein CSP1 protein. Length = 122 Score = 22.6 bits (46), Expect = 5.0 Identities = 9/29 (31%), Positives = 15/29 (51%) Frame = +2 Query: 254 IQADTYKMVSLNENLDIDRAHANYRAITN 340 + A K +N+D+DR +N R + N Sbjct: 15 VLASAQKYTDKFDNIDVDRVLSNDRILNN 43 >AY752908-1|AAV30082.1| 103|Anopheles gambiae peroxidase 13B protein. Length = 103 Score = 22.2 bits (45), Expect = 6.6 Identities = 11/30 (36%), Positives = 19/30 (63%), Gaps = 3/30 (10%) Frame = +2 Query: 269 YKMVSLNENLDIDR---AHANYRAITNLKR 349 + +++LN + D ++ NYRA+ NLKR Sbjct: 6 FDLIALNIHRGRDHGMPSYNNYRALCNLKR 35 >AF515521-1|AAM61888.1| 233|Anopheles gambiae glutathione S-transferase u1 protein. Length = 233 Score = 22.2 bits (45), Expect = 6.6 Identities = 9/24 (37%), Positives = 14/24 (58%) Frame = +2 Query: 305 DRAHANYRAITNLKRQFPQLRVFL 376 DRA N+R NL +PQ+ ++ Sbjct: 89 DRALVNHRLCFNLAFLYPQISAYV 112 >AY578801-1|AAT07306.1| 506|Anopheles gambiae dSmad2 protein. Length = 506 Score = 21.8 bits (44), Expect = 8.7 Identities = 7/15 (46%), Positives = 9/15 (60%) Frame = +3 Query: 162 AISENLKHVCCLRTW 206 A+ + L HV C R W Sbjct: 78 ALKKGLPHVICCRLW 92 >AJ973474-1|CAJ01521.1| 191|Anopheles gambiae hypothetical protein protein. Length = 191 Score = 21.8 bits (44), Expect = 8.7 Identities = 9/17 (52%), Positives = 12/17 (70%) Frame = +2 Query: 290 ENLDIDRAHANYRAITN 340 +NLDID A+ R +TN Sbjct: 33 DNLDIDTILASNRLVTN 49 >AJ697734-1|CAG26927.1| 191|Anopheles gambiae putative chemosensory protein CSP5 protein. Length = 191 Score = 21.8 bits (44), Expect = 8.7 Identities = 9/17 (52%), Positives = 12/17 (70%) Frame = +2 Query: 290 ENLDIDRAHANYRAITN 340 +NLDID A+ R +TN Sbjct: 33 DNLDIDTILASNRLVTN 49 >AJ439353-10|CAD27932.1| 3325|Anopheles gambiae F25C8.3 protein protein. Length = 3325 Score = 21.8 bits (44), Expect = 8.7 Identities = 9/23 (39%), Positives = 16/23 (69%) Frame = +2 Query: 311 AHANYRAITNLKRQFPQLRVFLT 379 + A+ ++NL+R+ PQ+R LT Sbjct: 913 SRASQSPLSNLRRKGPQVRPTLT 935 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 365,322 Number of Sequences: 2352 Number of extensions: 6739 Number of successful extensions: 23 Number of sequences better than 10.0: 16 Number of HSP's better than 10.0 without gapping: 22 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 22 length of database: 563,979 effective HSP length: 58 effective length of database: 427,563 effective search space used: 29074284 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -