BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0001_A12 (192 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AF236856-1|AAG17563.2| 370|Tribolium castaneum Kruppel protein ... 23 0.37 DQ855492-1|ABH88179.1| 251|Tribolium castaneum chemosensory pro... 20 2.6 AM292359-1|CAL23171.2| 436|Tribolium castaneum gustatory recept... 20 2.6 AY043292-1|AAK96031.1| 323|Tribolium castaneum homeodomain tran... 19 3.5 AF228509-1|AAF69136.1| 325|Tribolium castaneum prothoraxless pr... 19 3.5 AY055847-1|AAL23667.2| 312|Tribolium castaneum cephalothorax pr... 19 4.6 AY055846-1|AAL26542.2| 312|Tribolium castaneum cephalothorax pr... 19 4.6 AF426396-1|AAL27023.2| 312|Tribolium castaneum cephalothorax pr... 19 4.6 AF416773-1|AAL09697.1| 268|Tribolium castaneum cephalothorax pr... 19 4.6 AF321227-2|AAK16422.1| 312|Tribolium castaneum Scr protein. 19 4.6 AF264695-1|AAG13009.1| 100|Tribolium castaneum cephalothorax pr... 19 4.6 AF227628-1|AAF42868.1| 312|Tribolium castaneum sex combs reduce... 19 4.6 DQ855506-1|ABH88193.1| 124|Tribolium castaneum chemosensory pro... 19 6.1 AF426395-1|AAL27022.2| 297|Tribolium castaneum cephalothorax pr... 19 6.1 >AF236856-1|AAG17563.2| 370|Tribolium castaneum Kruppel protein protein. Length = 370 Score = 22.6 bits (46), Expect = 0.37 Identities = 9/13 (69%), Positives = 10/13 (76%) Frame = +2 Query: 119 AQQPARGDGAGGP 157 A+ AR DGAGGP Sbjct: 290 ARGAARADGAGGP 302 >DQ855492-1|ABH88179.1| 251|Tribolium castaneum chemosensory protein 6 protein. Length = 251 Score = 19.8 bits (39), Expect = 2.6 Identities = 10/34 (29%), Positives = 18/34 (52%), Gaps = 1/34 (2%) Frame = +2 Query: 32 RILPAEHRLCCAQC-RRLRGGAVGAPPRVRAQQP 130 R+LP + CA+C + R A + R++ + P Sbjct: 62 RVLPEALQTNCAKCTEKQRTAAYRSIKRLKKEYP 95 >AM292359-1|CAL23171.2| 436|Tribolium castaneum gustatory receptor candidate 38 protein. Length = 436 Score = 19.8 bits (39), Expect = 2.6 Identities = 7/27 (25%), Positives = 16/27 (59%) Frame = +3 Query: 6 RHAAALLDYGFYLLNIDCVVHSVAVYE 86 R A++DY F + + +++ + +YE Sbjct: 125 RFEEAVIDYLFTVYLLPIIINPLVLYE 151 >AY043292-1|AAK96031.1| 323|Tribolium castaneum homeodomain transcription factor Prothoraxlessprotein. Length = 323 Score = 19.4 bits (38), Expect = 3.5 Identities = 11/44 (25%), Positives = 21/44 (47%) Frame = +2 Query: 14 RRLTRLRILPAEHRLCCAQCRRLRGGAVGAPPRVRAQQPARGDG 145 R LTR R + H LC + R+++ + + + +G+G Sbjct: 265 RYLTRRRRIEIAHALCLTE-RQIKIWFQNRRMKWKKENKTKGEG 307 >AF228509-1|AAF69136.1| 325|Tribolium castaneum prothoraxless protein. Length = 325 Score = 19.4 bits (38), Expect = 3.5 Identities = 11/44 (25%), Positives = 21/44 (47%) Frame = +2 Query: 14 RRLTRLRILPAEHRLCCAQCRRLRGGAVGAPPRVRAQQPARGDG 145 R LTR R + H LC + R+++ + + + +G+G Sbjct: 267 RYLTRRRRIEIAHALCLTE-RQIKIWFQNRRMKWKKENKTKGEG 309 >AY055847-1|AAL23667.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 19.0 bits (37), Expect = 4.6 Identities = 8/19 (42%), Positives = 10/19 (52%) Frame = +2 Query: 14 RRLTRLRILPAEHRLCCAQ 70 R LTR R + H LC + Sbjct: 243 RYLTRRRRIEIAHALCLTE 261 >AY055846-1|AAL26542.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 19.0 bits (37), Expect = 4.6 Identities = 8/19 (42%), Positives = 10/19 (52%) Frame = +2 Query: 14 RRLTRLRILPAEHRLCCAQ 70 R LTR R + H LC + Sbjct: 243 RYLTRRRRIEIAHALCLTE 261 >AF426396-1|AAL27023.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 19.0 bits (37), Expect = 4.6 Identities = 8/19 (42%), Positives = 10/19 (52%) Frame = +2 Query: 14 RRLTRLRILPAEHRLCCAQ 70 R LTR R + H LC + Sbjct: 243 RYLTRRRRIEIAHALCLTE 261 >AF416773-1|AAL09697.1| 268|Tribolium castaneum cephalothorax protein. Length = 268 Score = 19.0 bits (37), Expect = 4.6 Identities = 8/19 (42%), Positives = 10/19 (52%) Frame = +2 Query: 14 RRLTRLRILPAEHRLCCAQ 70 R LTR R + H LC + Sbjct: 199 RYLTRRRRIEIAHALCLTE 217 >AF321227-2|AAK16422.1| 312|Tribolium castaneum Scr protein. Length = 312 Score = 19.0 bits (37), Expect = 4.6 Identities = 8/19 (42%), Positives = 10/19 (52%) Frame = +2 Query: 14 RRLTRLRILPAEHRLCCAQ 70 R LTR R + H LC + Sbjct: 243 RYLTRRRRIEIAHALCLTE 261 >AF264695-1|AAG13009.1| 100|Tribolium castaneum cephalothorax protein. Length = 100 Score = 19.0 bits (37), Expect = 4.6 Identities = 8/19 (42%), Positives = 10/19 (52%) Frame = +2 Query: 14 RRLTRLRILPAEHRLCCAQ 70 R LTR R + H LC + Sbjct: 31 RYLTRRRRIEIAHALCLTE 49 >AF227628-1|AAF42868.1| 312|Tribolium castaneum sex combs reduced Scr protein. Length = 312 Score = 19.0 bits (37), Expect = 4.6 Identities = 8/19 (42%), Positives = 10/19 (52%) Frame = +2 Query: 14 RRLTRLRILPAEHRLCCAQ 70 R LTR R + H LC + Sbjct: 243 RYLTRRRRIEIAHALCLTE 261 >DQ855506-1|ABH88193.1| 124|Tribolium castaneum chemosensory protein 20 protein. Length = 124 Score = 18.6 bits (36), Expect = 6.1 Identities = 6/14 (42%), Positives = 9/14 (64%) Frame = +2 Query: 32 RILPAEHRLCCAQC 73 R+LP + CA+C Sbjct: 64 RVLPDALKTSCAKC 77 >AF426395-1|AAL27022.2| 297|Tribolium castaneum cephalothorax protein. Length = 297 Score = 18.6 bits (36), Expect = 6.1 Identities = 8/16 (50%), Positives = 9/16 (56%) Frame = +2 Query: 14 RRLTRLRILPAEHRLC 61 R LTR R + H LC Sbjct: 243 RYLTRRRRIEIAHALC 258 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.313 0.148 0.518 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,683 Number of Sequences: 336 Number of extensions: 282 Number of successful extensions: 20 Number of sequences better than 10.0: 14 Number of HSP's better than 10.0 without gapping: 20 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 20 length of database: 122,585 effective HSP length: 43 effective length of database: 108,137 effective search space used: 2162740 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.2 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 34 (18.1 bits)
- SilkBase 1999-2023 -