BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0001_A12 (192 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_38091| Best HMM Match : Viral_Rep (HMM E-Value=5.1) 74 2e-14 SB_8454| Best HMM Match : ATP1G1_PLM_MAT8 (HMM E-Value=6.5) 74 2e-14 SB_2152| Best HMM Match : EGF (HMM E-Value=0) 33 0.037 SB_45079| Best HMM Match : RRM_1 (HMM E-Value=0.0027) 30 0.26 SB_19932| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 2.4 SB_28395| Best HMM Match : RRM_1 (HMM E-Value=3.9e-25) 26 5.5 SB_35533| Best HMM Match : Ldl_recept_b (HMM E-Value=9.8e-05) 25 9.7 >SB_38091| Best HMM Match : Viral_Rep (HMM E-Value=5.1) Length = 156 Score = 74.1 bits (174), Expect = 2e-14 Identities = 35/62 (56%), Positives = 45/62 (72%) Frame = +3 Query: 6 RHAAALLDYGFYLLNIDCVVHSVAVYEEALSALRRVYGRSSLHVATAQEDLAYALYVLEY 185 + A L+DYGFYLLN+D + SV VY+ A V+G ++LHVATA EDLAYA+YV EY Sbjct: 18 KFADVLVDYGFYLLNVDSIHLSVQVYKTAFRIRSEVFGVNNLHVATAHEDLAYAMYVHEY 77 Query: 186 SS 191 S+ Sbjct: 78 ST 79 >SB_8454| Best HMM Match : ATP1G1_PLM_MAT8 (HMM E-Value=6.5) Length = 321 Score = 74.1 bits (174), Expect = 2e-14 Identities = 35/62 (56%), Positives = 45/62 (72%) Frame = +3 Query: 6 RHAAALLDYGFYLLNIDCVVHSVAVYEEALSALRRVYGRSSLHVATAQEDLAYALYVLEY 185 + A L+DYGFYLLN+D + SV VY+ A V+G ++LHVATA EDLAYA+YV EY Sbjct: 253 KFADVLVDYGFYLLNVDSIHLSVQVYKTAFRIRSEVFGVNNLHVATAHEDLAYAMYVHEY 312 Query: 186 SS 191 S+ Sbjct: 313 ST 314 >SB_2152| Best HMM Match : EGF (HMM E-Value=0) Length = 1603 Score = 33.1 bits (72), Expect = 0.037 Identities = 15/25 (60%), Positives = 16/25 (64%) Frame = +2 Query: 35 ILPAEHRLCCAQCRRLRGGAVGAPP 109 ILP +HR C CRRL G A APP Sbjct: 1238 ILPRQHR--CVTCRRLEGRAYAAPP 1260 >SB_45079| Best HMM Match : RRM_1 (HMM E-Value=0.0027) Length = 253 Score = 30.3 bits (65), Expect = 0.26 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = +2 Query: 77 RLRGGAVGAPPRVRAQQPARGDGAGGPRVRA 169 R GG++ P R R++ P RG G PR R+ Sbjct: 177 RRGGGSMSPPRRSRSRSPRRGGRGGSPRQRS 207 >SB_19932| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2201 Score = 27.1 bits (57), Expect = 2.4 Identities = 14/28 (50%), Positives = 15/28 (53%) Frame = +2 Query: 32 RILPAEHRLCCAQCRRLRGGAVGAPPRV 115 R+LP HR CC Q R G AV RV Sbjct: 2054 RVLPYAHRECCKQRVRKYGLAVNLRRRV 2081 >SB_28395| Best HMM Match : RRM_1 (HMM E-Value=3.9e-25) Length = 159 Score = 25.8 bits (54), Expect = 5.5 Identities = 12/28 (42%), Positives = 14/28 (50%) Frame = +2 Query: 98 GAPPRVRAQQPARGDGAGGPRVRALRAG 181 G P +V QP GAGG R R+G Sbjct: 72 GRPMKVNQAQPRGERGAGGSRAGGYRSG 99 >SB_35533| Best HMM Match : Ldl_recept_b (HMM E-Value=9.8e-05) Length = 909 Score = 25.0 bits (52), Expect = 9.7 Identities = 12/34 (35%), Positives = 17/34 (50%) Frame = +3 Query: 54 DCVVHSVAVYEEALSALRRVYGRSSLHVATAQED 155 DCV+ VY +++ + RVY S L A D Sbjct: 485 DCVLSQARVYRDSVLSQARVYRDSVLSQARVYRD 518 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.313 0.148 0.518 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,331,210 Number of Sequences: 59808 Number of extensions: 48188 Number of successful extensions: 161 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 158 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 160 length of database: 16,821,457 effective HSP length: 42 effective length of database: 14,309,521 effective search space used: 300499941 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.2 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (21.7 bits)
- SilkBase 1999-2023 -