BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0001_A06 (511 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ667194-1|ABG75746.1| 391|Apis mellifera cys-loop ligand-gated... 24 1.1 AY336529-1|AAQ02340.1| 712|Apis mellifera transferrin protein. 23 1.8 AY336528-1|AAQ02339.1| 712|Apis mellifera transferrin protein. 23 1.8 AY217097-1|AAO39761.1| 712|Apis mellifera transferrin protein. 23 1.8 AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul... 23 1.8 AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A... 23 1.8 AF069739-1|AAC63272.2| 690|Apis mellifera translation initiatio... 22 3.2 DQ026034-1|AAY87893.1| 569|Apis mellifera nicotinic acetylcholi... 22 4.2 DQ026033-1|AAY87892.1| 569|Apis mellifera nicotinic acetylcholi... 22 4.2 AB207270-1|BAE72137.1| 429|Apis mellifera broad-complex protein. 21 7.4 >DQ667194-1|ABG75746.1| 391|Apis mellifera cys-loop ligand-gated ion channel subunit protein. Length = 391 Score = 23.8 bits (49), Expect = 1.1 Identities = 10/25 (40%), Positives = 18/25 (72%), Gaps = 1/25 (4%) Frame = -1 Query: 142 LEIWMFGCMV-VFLSYHDSLLEEVL 71 L++WM GCM+ VF + + ++ +VL Sbjct: 262 LDVWMAGCMMFVFAALGEFVVVKVL 286 >AY336529-1|AAQ02340.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 23.0 bits (47), Expect = 1.8 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = +1 Query: 37 VDAKTKPCFYL*VPLQG 87 +DA TKPC + P QG Sbjct: 294 IDANTKPCTWAARPWQG 310 >AY336528-1|AAQ02339.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 23.0 bits (47), Expect = 1.8 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = +1 Query: 37 VDAKTKPCFYL*VPLQG 87 +DA TKPC + P QG Sbjct: 294 IDANTKPCTWAARPWQG 310 >AY217097-1|AAO39761.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 23.0 bits (47), Expect = 1.8 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = +1 Query: 37 VDAKTKPCFYL*VPLQG 87 +DA TKPC + P QG Sbjct: 294 IDANTKPCTWAARPWQG 310 >AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule AbsCAM-Ig7B protein. Length = 1923 Score = 23.0 bits (47), Expect = 1.8 Identities = 12/23 (52%), Positives = 14/23 (60%) Frame = -2 Query: 306 VAGTISGGKCRKILRYSIPSFVK 238 V G S G C +LR +PSFVK Sbjct: 138 VIGGASRG-CTAVLRCVVPSFVK 159 >AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member AbsCAM-Ig7A protein. Length = 1919 Score = 23.0 bits (47), Expect = 1.8 Identities = 12/23 (52%), Positives = 14/23 (60%) Frame = -2 Query: 306 VAGTISGGKCRKILRYSIPSFVK 238 V G S G C +LR +PSFVK Sbjct: 138 VIGGASRG-CTAVLRCVVPSFVK 159 >AF069739-1|AAC63272.2| 690|Apis mellifera translation initiation factor 2 protein. Length = 690 Score = 22.2 bits (45), Expect = 3.2 Identities = 13/37 (35%), Positives = 17/37 (45%), Gaps = 2/37 (5%) Frame = +2 Query: 107 KDYHAPKHPDLEKI--PNLQVIKAMQSLKSRGYVKEQ 211 KD P + KI PN+ +IK L G V E+ Sbjct: 242 KDAKVPIIVAINKIDKPNIDIIKVQYELAKHGIVIEE 278 >DQ026034-1|AAY87893.1| 569|Apis mellifera nicotinic acetylcholine receptor alpha4subunit protein. Length = 569 Score = 21.8 bits (44), Expect = 4.2 Identities = 7/18 (38%), Positives = 13/18 (72%) Frame = +1 Query: 13 SGKLVVQDVDAKTKPCFY 66 SG+++++ V K K C+Y Sbjct: 373 SGRVLMRTVRGKEKTCYY 390 >DQ026033-1|AAY87892.1| 569|Apis mellifera nicotinic acetylcholine receptor alpha4subunit protein. Length = 569 Score = 21.8 bits (44), Expect = 4.2 Identities = 7/18 (38%), Positives = 13/18 (72%) Frame = +1 Query: 13 SGKLVVQDVDAKTKPCFY 66 SG+++++ V K K C+Y Sbjct: 373 SGRVLMRTVRGKEKTCYY 390 >AB207270-1|BAE72137.1| 429|Apis mellifera broad-complex protein. Length = 429 Score = 21.0 bits (42), Expect = 7.4 Identities = 11/37 (29%), Positives = 17/37 (45%) Frame = +2 Query: 275 LHLPPEIVPATLKRSVRTETVRRGAVGRPDAPARTAE 385 L P P T+++ +R +RR PD TA+ Sbjct: 156 LPTPVTPTPTTVQQLLRRAQIRRNERRTPDPHDETAK 192 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 137,310 Number of Sequences: 438 Number of extensions: 2802 Number of successful extensions: 10 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 14109465 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -