BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0001_A05 (285 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U53153-9|AAC69041.1| 511|Caenorhabditis elegans Hypothetical pr... 25 6.6 Z68880-3|CAA93096.1| 138|Caenorhabditis elegans Hypothetical pr... 25 8.7 >U53153-9|AAC69041.1| 511|Caenorhabditis elegans Hypothetical protein T19A5.5 protein. Length = 511 Score = 25.4 bits (53), Expect = 6.6 Identities = 10/35 (28%), Positives = 22/35 (62%) Frame = -2 Query: 122 VHFFEPLIKTTGSNRV*RVMGVTQKYSLILGTKMR 18 V++FE + S+R+ +++ + +KY I+G K + Sbjct: 450 VYYFEQDRMSRYSHRLLKILKINEKYKTIMGEKRK 484 >Z68880-3|CAA93096.1| 138|Caenorhabditis elegans Hypothetical protein T14G10.4 protein. Length = 138 Score = 25.0 bits (52), Expect = 8.7 Identities = 9/18 (50%), Positives = 13/18 (72%) Frame = +1 Query: 19 RIFVPKINEYFCVTPITL 72 ++FVP+ N+YF PI L Sbjct: 120 KVFVPQTNDYFTKHPIIL 137 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 6,616,245 Number of Sequences: 27780 Number of extensions: 114955 Number of successful extensions: 211 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 210 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 211 length of database: 12,740,198 effective HSP length: 69 effective length of database: 10,823,378 effective search space used: 270584450 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -