BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0001_A04 (409 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 08_01_0321 + 2872609-2873027,2873477-2873905,2874743-2874944,287... 33 0.066 11_06_0177 + 20936072-20937550 27 4.3 11_01_0220 + 1717861-1717979,1718149-1718281,1718544-1718723,171... 27 5.7 11_04_0090 - 13391028-13391117,13391369-13391502,13391532-133916... 27 7.6 11_01_0779 + 6518556-6518601,6519825-6519967,6520091-6520114,652... 27 7.6 06_03_0153 + 17300907-17301455 27 7.6 >08_01_0321 + 2872609-2873027,2873477-2873905,2874743-2874944, 2875909-2875947,2876309-2876354,2877380-2877922, 2878827-2880847,2880972-2881215,2881642-2881684, 2881923-2881962,2883580-2883675,2883712-2883759, 2883964-2884290 Length = 1498 Score = 33.5 bits (73), Expect = 0.066 Identities = 20/53 (37%), Positives = 24/53 (45%), Gaps = 1/53 (1%) Frame = +2 Query: 167 GSRDVGRTS*NS-DVSIGAATALACALSDVAVFACTVASFSPSNPISRTHRVY 322 G D GRTS S D I ALA + + V A P+ P+ RT R Y Sbjct: 1170 GFNDFGRTSLKSVDARIHCKDALAAEVQEAEVALANAAHGHPNRPVLRTDRAY 1222 >11_06_0177 + 20936072-20937550 Length = 492 Score = 27.5 bits (58), Expect = 4.3 Identities = 16/48 (33%), Positives = 24/48 (50%) Frame = +2 Query: 134 DFTGSVAQSSIGSRDVGRTS*NSDVSIGAATALACALSDVAVFACTVA 277 DF G +A + RDV + + N V + AA + A++ A AC A Sbjct: 437 DFQG-LAVVTEDDRDVAQGACNFSVQVAAAALVGAAVAAAAAVACAAA 483 >11_01_0220 + 1717861-1717979,1718149-1718281,1718544-1718723, 1719046-1719126,1719259-1719422,1719518-1719654, 1719900-1720015,1720134-1720367 Length = 387 Score = 27.1 bits (57), Expect = 5.7 Identities = 14/27 (51%), Positives = 15/27 (55%) Frame = +2 Query: 215 GAATALACALSDVAVFACTVASFSPSN 295 G ALA +VAVFA SFS SN Sbjct: 172 GFEAALAAGAKEVAVFASASESFSKSN 198 >11_04_0090 - 13391028-13391117,13391369-13391502,13391532-13391659, 13391684-13391718,13391719-13392159 Length = 275 Score = 26.6 bits (56), Expect = 7.6 Identities = 13/29 (44%), Positives = 18/29 (62%) Frame = +2 Query: 221 ATALACALSDVAVFACTVASFSPSNPISR 307 A A + LS +A A ++S SPS P+SR Sbjct: 2 AFAASPPLSSLAAAAAVISSSSPSKPLSR 30 >11_01_0779 + 6518556-6518601,6519825-6519967,6520091-6520114, 6520140-6520286,6521957-6522142,6522232-6522490, 6522738-6522969,6523081-6523231,6523322-6523499, 6523916-6524191,6524414-6524642,6524754-6524904, 6525013-6525192 Length = 733 Score = 26.6 bits (56), Expect = 7.6 Identities = 13/51 (25%), Positives = 26/51 (50%) Frame = -2 Query: 309 VLDMGLLGLKLATVQANTATSESAHARAVAAPIETSLFQDVRPTSRDPMLD 157 + +G+L L++ T N +TS+ +R + + + + TSR P L+ Sbjct: 365 IFSLGILILEIVTGLKNDSTSQEVSSRILIDNVRRKWLKSSQITSRYPSLE 415 >06_03_0153 + 17300907-17301455 Length = 182 Score = 26.6 bits (56), Expect = 7.6 Identities = 19/52 (36%), Positives = 27/52 (51%), Gaps = 6/52 (11%) Frame = +2 Query: 143 GSVAQSSIGSRDVGRTS*NSD------VSIGAATALACALSDVAVFACTVAS 280 G A+ R+VGR + SD S GAA+ALA A++ A + + AS Sbjct: 67 GDAARCGAAVREVGRLARESDRDRWCLASSGAASALAAAVASFAAVSDSSAS 118 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,717,269 Number of Sequences: 37544 Number of extensions: 159627 Number of successful extensions: 407 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 404 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 407 length of database: 14,793,348 effective HSP length: 75 effective length of database: 11,977,548 effective search space used: 718652880 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -