BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0001_A03 (309 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY785360-1|AAV52864.1| 759|Anopheles gambiae male-specific tran... 25 0.85 AY725820-1|AAU50568.1| 593|Anopheles gambiae fruitless female-s... 23 2.0 AY725819-1|AAU50567.1| 569|Anopheles gambiae fruitless male-spe... 23 2.0 CR954257-14|CAJ14165.1| 1726|Anopheles gambiae BEL12_AG transpos... 22 4.5 >AY785360-1|AAV52864.1| 759|Anopheles gambiae male-specific transcription factor FRU-MB protein. Length = 759 Score = 24.6 bits (51), Expect = 0.85 Identities = 9/29 (31%), Positives = 12/29 (41%) Frame = +3 Query: 15 CRNSARGVLHARTEVHSTVKQTIQCPFCR 101 C+ + V H R H +CP CR Sbjct: 502 CKLCGKVVTHIRNHYHVHFPGRFECPLCR 530 >AY725820-1|AAU50568.1| 593|Anopheles gambiae fruitless female-specific zinc-fingerC isoform protein. Length = 593 Score = 23.4 bits (48), Expect = 2.0 Identities = 9/28 (32%), Positives = 13/28 (46%) Frame = +3 Query: 15 CRNSARGVLHARTEVHSTVKQTIQCPFC 98 CR+ + V + HS Q CP+C Sbjct: 529 CRSCGKEVTNRWHHFHSHTPQRSLCPYC 556 >AY725819-1|AAU50567.1| 569|Anopheles gambiae fruitless male-specific zinc-fingerC isoform protein. Length = 569 Score = 23.4 bits (48), Expect = 2.0 Identities = 9/28 (32%), Positives = 13/28 (46%) Frame = +3 Query: 15 CRNSARGVLHARTEVHSTVKQTIQCPFC 98 CR+ + V + HS Q CP+C Sbjct: 505 CRSCGKEVTNRWHHFHSHTPQRSLCPYC 532 >CR954257-14|CAJ14165.1| 1726|Anopheles gambiae BEL12_AG transposon polyprotein protein. Length = 1726 Score = 22.2 bits (45), Expect = 4.5 Identities = 9/30 (30%), Positives = 14/30 (46%) Frame = +3 Query: 9 RGCRNSARGVLHARTEVHSTVKQTIQCPFC 98 R R R V + ++T K ++CP C Sbjct: 318 RQARRDGRNVALPVQQTNNTFKGYLKCPLC 347 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 345,693 Number of Sequences: 2352 Number of extensions: 6018 Number of successful extensions: 12 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 563,979 effective HSP length: 56 effective length of database: 432,267 effective search space used: 19884282 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -