BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0001_A03 (309 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g33880.1 68415.m04159 expressed protein 26 4.5 At4g19370.1 68417.m02852 hypothetical protein 25 7.8 >At2g33880.1 68415.m04159 expressed protein Length = 378 Score = 26.2 bits (55), Expect = 4.5 Identities = 12/23 (52%), Positives = 15/23 (65%) Frame = +1 Query: 184 KWQHYLECMLLNMASGISSPFST 252 +WQH + LL AS SSPFS+ Sbjct: 20 QWQHDINSPLLPSASHRSSPFSS 42 >At4g19370.1 68417.m02852 hypothetical protein Length = 217 Score = 25.4 bits (53), Expect = 7.8 Identities = 15/43 (34%), Positives = 22/43 (51%) Frame = +2 Query: 44 RKDGSS*YSQTNNTVSFLSSALNFIIMVII*STYVCCVNNNSY 172 R+DG T TV L S NF+++V+I ST + +Y Sbjct: 81 REDGYKITDLTLPTVLLLLSWSNFVVVVLILSTAISMSRAQAY 123 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 6,827,569 Number of Sequences: 28952 Number of extensions: 114957 Number of successful extensions: 244 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 241 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 244 length of database: 12,070,560 effective HSP length: 70 effective length of database: 10,043,920 effective search space used: 321405440 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -