BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG1054 (606 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_06_0491 - 29763738-29764044,29764266-29764474,29764565-297646... 40 0.002 05_06_0213 + 26414613-26414695,26416907-26417077,26417983-264182... 37 0.011 01_06_0090 + 26358051-26359157,26359582-26359701,26359968-263600... 29 2.9 08_02_1596 + 28125331-28125556,28125986-28126047,28126160-281261... 29 3.8 01_01_1200 - 9670109-9670165,9670569-9670664,9670886-9670969,967... 29 3.8 11_01_0221 - 1720952-1721164,1721351-1721428,1721836-1721895,172... 28 6.6 01_01_0098 + 744582-745380,746107-746130,746500-747569 27 8.7 >01_06_0491 - 29763738-29764044,29764266-29764474,29764565-29764654, 29764819-29764905,29765598-29765733,29766036-29766186, 29766334-29766502 Length = 382 Score = 39.9 bits (89), Expect = 0.002 Identities = 22/62 (35%), Positives = 36/62 (58%) Frame = -1 Query: 591 GAKYALDQDASLHAKINNKSLIGLGYQQKLRPGVTLTLSAAIDGQNFNAGGHKVGVALEL 412 G ++ALD ++ A+ NN ++ Q + RP LTLSA +D + + KVG++L L Sbjct: 322 GMQHALDPLTTVKARYNNHGMVSALIQHEWRPKSFLTLSAEVDTKAIDKAS-KVGLSLVL 380 Query: 411 EP 406 +P Sbjct: 381 KP 382 >05_06_0213 + 26414613-26414695,26416907-26417077,26417983-26418219, 26418543-26418572,26419248-26419282,26421680-26421747, 26423067-26423126,26423310-26423399,26423487-26423695, 26424083-26424383 Length = 427 Score = 37.1 bits (82), Expect = 0.011 Identities = 19/62 (30%), Positives = 35/62 (56%) Frame = -1 Query: 591 GAKYALDQDASLHAKINNKSLIGLGYQQKLRPGVTLTLSAAIDGQNFNAGGHKVGVALEL 412 G ++ALD+ ++ A+ NN + Q + RP +T+S +D + + KVG++L L Sbjct: 367 GTQHALDELTTVKARFNNFGMASALIQHEFRPKSLVTISTEVDTKAIDKSS-KVGLSLVL 425 Query: 411 EP 406 +P Sbjct: 426 KP 427 >01_06_0090 + 26358051-26359157,26359582-26359701,26359968-26360099, 26360194-26360375,26360488-26360602,26362001-26362135, 26362261-26362395 Length = 641 Score = 29.1 bits (62), Expect = 2.9 Identities = 16/42 (38%), Positives = 23/42 (54%), Gaps = 5/42 (11%) Frame = -2 Query: 452 SMQVATRLALPSNSSPR-----KYNPTYSCR*IHTVVTTKQR 342 S ++R++LPS S+P +PTYSC TV T + R Sbjct: 221 SYSASSRVSLPSTSAPSPSSSTSTSPTYSCSSSDTVTTPRNR 262 >08_02_1596 + 28125331-28125556,28125986-28126047,28126160-28126199, 28126934-28127029,28127138-28127169,28127274-28127349, 28127430-28127483,28127916-28127941 Length = 203 Score = 28.7 bits (61), Expect = 3.8 Identities = 13/31 (41%), Positives = 19/31 (61%) Frame = -3 Query: 403 ENITQPTLVDKYILLSQPNSVYRESISIVEI 311 E + + T+VDK I LS PNSV + + E+ Sbjct: 141 EGVAEATIVDKQIPLSGPNSVVGRAFVVHEL 171 >01_01_1200 - 9670109-9670165,9670569-9670664,9670886-9670969, 9671050-9671118,9671892-9671993,9672807-9672872, 9673791-9673841,9673953-9674048,9674141-9674279, 9674343-9674424,9674528-9674723 Length = 345 Score = 28.7 bits (61), Expect = 3.8 Identities = 15/43 (34%), Positives = 22/43 (51%) Frame = -1 Query: 591 GAKYALDQDASLHAKINNKSLIGLGYQQKLRPGVTLTLSAAID 463 G Y L Q L KI+ ++ +++L PGV LSA +D Sbjct: 288 GYDYMLRQ-CRLRGKIDTNGVVSALLEERLTPGVNFVLSAELD 329 >11_01_0221 - 1720952-1721164,1721351-1721428,1721836-1721895, 1721996-1722099,1722214-1722372,1722668-1722794, 1723469-1723636,1723789-1723899,1723989-1724142, 1724308-1724643,1724753-1724937,1725040-1725138, 1725275-1725538,1725674-1725850,1726249-1726542, 1726649-1726816,1727473-1727817,1727901-1728070, 1728171-1728321,1729193-1729262,1729353-1729537, 1729896-1729989,1730094-1730212,1730558-1730617, 1730744-1730830,1732348-1732434,1732622-1732730, 1732822-1732900,1733067-1733154,1733328-1733392, 1734287-1734439,1735231-1735337,1735419-1735501, 1735643-1735733,1735812-1735948,1736118-1736207, 1736301-1736468,1736875-1737057 Length = 1805 Score = 27.9 bits (59), Expect = 6.6 Identities = 11/16 (68%), Positives = 13/16 (81%) Frame = -2 Query: 485 LHCLLPSMDRTSMQVA 438 LHCLLPS++R S Q A Sbjct: 722 LHCLLPSINRNSSQAA 737 >01_01_0098 + 744582-745380,746107-746130,746500-747569 Length = 630 Score = 27.5 bits (58), Expect = 8.7 Identities = 14/28 (50%), Positives = 17/28 (60%) Frame = -2 Query: 548 RSTTSPSSVLVTNRNYAQA*PLHCLLPS 465 R TTS S LV+ R Y A PL C++ S Sbjct: 173 RDTTSHFSYLVSTRLYLYALPLDCMVVS 200 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,523,467 Number of Sequences: 37544 Number of extensions: 302411 Number of successful extensions: 720 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 708 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 719 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1442939384 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -