BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG1054 (606 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ999006-1|ABJ99082.1| 282|Anopheles gambiae voltage-dependent ... 109 7e-26 AY137768-1|AAN16031.1| 282|Anopheles gambiae porin protein. 109 7e-26 AY082909-1|AAL89811.1| 282|Anopheles gambiae porin protein. 109 7e-26 >DQ999006-1|ABJ99082.1| 282|Anopheles gambiae voltage-dependent anion channel protein. Length = 282 Score = 109 bits (262), Expect = 7e-26 Identities = 49/66 (74%), Positives = 58/66 (87%) Frame = -1 Query: 606 TLFGVGAKYALDQDASLHAKINNKSLIGLGYQQKLRPGVTLTLSAAIDGQNFNAGGHKVG 427 T FG+GAKY LD+DA + AK+NN+S IGLGYQQKLR G+TLTLS +DG+NFNAGGHK+G Sbjct: 216 TKFGMGAKYDLDKDACVRAKVNNQSQIGLGYQQKLRDGITLTLSTLVDGKNFNAGGHKIG 275 Query: 426 VALELE 409 VALELE Sbjct: 276 VALELE 281 >AY137768-1|AAN16031.1| 282|Anopheles gambiae porin protein. Length = 282 Score = 109 bits (262), Expect = 7e-26 Identities = 49/66 (74%), Positives = 58/66 (87%) Frame = -1 Query: 606 TLFGVGAKYALDQDASLHAKINNKSLIGLGYQQKLRPGVTLTLSAAIDGQNFNAGGHKVG 427 T FG+GAKY LD+DA + AK+NN+S IGLGYQQKLR G+TLTLS +DG+NFNAGGHK+G Sbjct: 216 TKFGMGAKYDLDKDACVRAKVNNQSQIGLGYQQKLRDGITLTLSTLVDGKNFNAGGHKIG 275 Query: 426 VALELE 409 VALELE Sbjct: 276 VALELE 281 >AY082909-1|AAL89811.1| 282|Anopheles gambiae porin protein. Length = 282 Score = 109 bits (262), Expect = 7e-26 Identities = 49/66 (74%), Positives = 58/66 (87%) Frame = -1 Query: 606 TLFGVGAKYALDQDASLHAKINNKSLIGLGYQQKLRPGVTLTLSAAIDGQNFNAGGHKVG 427 T FG+GAKY LD+DA + AK+NN+S IGLGYQQKLR G+TLTLS +DG+NFNAGGHK+G Sbjct: 216 TKFGMGAKYDLDKDACVRAKVNNQSQIGLGYQQKLRDGITLTLSTLVDGKNFNAGGHKIG 275 Query: 426 VALELE 409 VALELE Sbjct: 276 VALELE 281 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 620,641 Number of Sequences: 2352 Number of extensions: 13299 Number of successful extensions: 23 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 23 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 23 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 58870980 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -