BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG1050 (674 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value EF625899-1|ABR45906.1| 1010|Apis mellifera high Glx storage prot... 25 0.66 DQ863218-1|ABI94394.1| 399|Apis mellifera tyramine receptor pro... 24 1.5 DQ863217-1|ABI94393.1| 399|Apis mellifera tyramine receptor pro... 24 1.5 AJ245824-1|CAB76374.1| 399|Apis mellifera G-protein coupled rec... 24 1.5 AB208108-1|BAE72140.1| 92|Apis mellifera Broad complex zinc fi... 23 2.7 AF015267-1|AAC38959.1| 461|Apis mellifera elongation factor-1al... 22 4.7 AF388659-3|AAK71993.1| 548|Apis mellifera 1D-myo-inositol-trisp... 22 6.1 AF388659-2|AAK71994.1| 463|Apis mellifera 1D-myo-inositol-trisp... 22 6.1 AF388659-1|AAK71995.1| 782|Apis mellifera 1D-myo-inositol-trisp... 22 6.1 >EF625899-1|ABR45906.1| 1010|Apis mellifera high Glx storage protein protein. Length = 1010 Score = 25.0 bits (52), Expect = 0.66 Identities = 11/24 (45%), Positives = 14/24 (58%) Frame = -1 Query: 608 GFHDNRVPGSDGSGHRQKQQLQGI 537 G H N P S SG +Q+ LQG+ Sbjct: 812 GLHINSSPSSVQSGQQQQSVLQGL 835 >DQ863218-1|ABI94394.1| 399|Apis mellifera tyramine receptor protein. Length = 399 Score = 23.8 bits (49), Expect = 1.5 Identities = 10/28 (35%), Positives = 14/28 (50%) Frame = +2 Query: 239 SRHNQADRMAPSAAQEFVKNVRGKPKRH 322 +RH +AD S + E N R P+ H Sbjct: 242 TRHREADDAEESVSSETNHNERSTPRSH 269 >DQ863217-1|ABI94393.1| 399|Apis mellifera tyramine receptor protein. Length = 399 Score = 23.8 bits (49), Expect = 1.5 Identities = 10/28 (35%), Positives = 14/28 (50%) Frame = +2 Query: 239 SRHNQADRMAPSAAQEFVKNVRGKPKRH 322 +RH +AD S + E N R P+ H Sbjct: 242 TRHREADDAEESVSSETNHNERSTPRSH 269 >AJ245824-1|CAB76374.1| 399|Apis mellifera G-protein coupled receptor protein. Length = 399 Score = 23.8 bits (49), Expect = 1.5 Identities = 10/28 (35%), Positives = 14/28 (50%) Frame = +2 Query: 239 SRHNQADRMAPSAAQEFVKNVRGKPKRH 322 +RH +AD S + E N R P+ H Sbjct: 242 TRHREADDAEESVSSETNHNERSTPRSH 269 >AB208108-1|BAE72140.1| 92|Apis mellifera Broad complex zinc finger domain-Z3 isoform protein. Length = 92 Score = 23.0 bits (47), Expect = 2.7 Identities = 7/13 (53%), Positives = 10/13 (76%) Frame = +2 Query: 227 RHFQSRHNQADRM 265 RHFQ +H Q+D + Sbjct: 23 RHFQDKHEQSDTL 35 >AF015267-1|AAC38959.1| 461|Apis mellifera elongation factor-1alpha F2 protein. Length = 461 Score = 22.2 bits (45), Expect = 4.7 Identities = 7/19 (36%), Positives = 12/19 (63%) Frame = +3 Query: 447 HPPKGFVNILDEVVIYNDP 503 +PPKG + +V++ N P Sbjct: 332 NPPKGAADFTAQVIVLNHP 350 >AF388659-3|AAK71993.1| 548|Apis mellifera 1D-myo-inositol-trisphosphate 3-kinaseisoform C protein. Length = 548 Score = 21.8 bits (44), Expect = 6.1 Identities = 12/35 (34%), Positives = 18/35 (51%) Frame = +2 Query: 212 RPKSSRHFQSRHNQADRMAPSAAQEFVKNVRGKPK 316 RPK + + Q D AP+A + V+ V KP+ Sbjct: 365 RPKLRKDMYEKMVQVDPTAPNAEERRVQGVT-KPR 398 >AF388659-2|AAK71994.1| 463|Apis mellifera 1D-myo-inositol-trisphosphate 3-kinaseisoform B protein. Length = 463 Score = 21.8 bits (44), Expect = 6.1 Identities = 12/35 (34%), Positives = 18/35 (51%) Frame = +2 Query: 212 RPKSSRHFQSRHNQADRMAPSAAQEFVKNVRGKPK 316 RPK + + Q D AP+A + V+ V KP+ Sbjct: 280 RPKLRKDMYEKMVQVDPTAPNAEERRVQGVT-KPR 313 >AF388659-1|AAK71995.1| 782|Apis mellifera 1D-myo-inositol-trisphosphate 3-kinaseisoform A protein. Length = 782 Score = 21.8 bits (44), Expect = 6.1 Identities = 12/35 (34%), Positives = 18/35 (51%) Frame = +2 Query: 212 RPKSSRHFQSRHNQADRMAPSAAQEFVKNVRGKPK 316 RPK + + Q D AP+A + V+ V KP+ Sbjct: 599 RPKLRKDMYEKMVQVDPTAPNAEERRVQGVT-KPR 632 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 179,472 Number of Sequences: 438 Number of extensions: 3628 Number of successful extensions: 14 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 20464920 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -