BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG1049 (558 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g22680.1 68418.m02650 hypothetical protein 28 3.7 At2g25280.1 68415.m03024 expressed protein 27 8.5 >At5g22680.1 68418.m02650 hypothetical protein Length = 235 Score = 28.3 bits (60), Expect = 3.7 Identities = 11/31 (35%), Positives = 16/31 (51%) Frame = +1 Query: 106 DHSFIYGSVMYLCYTFLRFSNNSFLDFTKIV 198 D F + + YLC+ FL + FLD+ V Sbjct: 21 DLDFDFVEICYLCFFFLDLDSKEFLDYNAFV 51 >At2g25280.1 68415.m03024 expressed protein Length = 291 Score = 27.1 bits (57), Expect = 8.5 Identities = 12/29 (41%), Positives = 17/29 (58%) Frame = -1 Query: 345 FSYMTYNNLENPIYN*IEVNFKKNLQLIE 259 F+YM Y+N I+ IE KK + +IE Sbjct: 193 FNYMHYDNTHGAIHKSIEALDKKGMDIIE 221 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,585,046 Number of Sequences: 28952 Number of extensions: 165450 Number of successful extensions: 211 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 208 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 211 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 1062855648 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -