BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG1047 (575 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_43520| Best HMM Match : RNase_PH (HMM E-Value=0.00011) 30 1.2 SB_16698| Best HMM Match : Y_phosphatase (HMM E-Value=0) 29 3.6 >SB_43520| Best HMM Match : RNase_PH (HMM E-Value=0.00011) Length = 972 Score = 30.3 bits (65), Expect = 1.2 Identities = 8/22 (36%), Positives = 13/22 (59%) Frame = +2 Query: 83 YVYMKCYCHKFCLFFIYTYLVF 148 Y Y CYC+ +C ++ Y Y + Sbjct: 477 YYYCYCYCYYYCYYYCYCYCYY 498 Score = 29.9 bits (64), Expect = 1.6 Identities = 8/24 (33%), Positives = 14/24 (58%) Frame = +2 Query: 80 KYVYMKCYCHKFCLFFIYTYLVFF 151 +Y Y CYC+ +C + Y Y ++ Sbjct: 468 RYCYCYCYCYYYCYCYCYYYCYYY 491 >SB_16698| Best HMM Match : Y_phosphatase (HMM E-Value=0) Length = 839 Score = 28.7 bits (61), Expect = 3.6 Identities = 11/35 (31%), Positives = 18/35 (51%) Frame = +2 Query: 104 CHKFCLFFIYTYLVFFDCMIISNNKKYRIKLLPIF 208 C +F YTY+V + + I + +YR +L F Sbjct: 584 CSNIVYYFTYTYVVLDEALDIGHGSRYRPRLRQFF 618 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,422,530 Number of Sequences: 59808 Number of extensions: 227147 Number of successful extensions: 447 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 362 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 433 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1373676929 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -