BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG1046 (619 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC1271.11 |||tricarboxylate transporter |Schizosaccharomyces p... 28 0.94 SPAC2C4.10c |||sequence orphan|Schizosaccharomyces pombe|chr 1||... 27 1.6 SPAC12G12.16c ||SPAC18B11.01c|nuclease, XP-G family|Schizosaccha... 25 6.6 SPCPB1C11.02 |||amino acid permease, unknown 16|Schizosaccharomy... 25 6.6 SPAC3A11.10c |||dipeptidyl aminopeptidase |Schizosaccharomyces p... 25 6.6 >SPBC1271.11 |||tricarboxylate transporter |Schizosaccharomyces pombe|chr 2|||Manual Length = 258 Score = 28.3 bits (60), Expect = 0.94 Identities = 16/35 (45%), Positives = 22/35 (62%), Gaps = 1/35 (2%) Frame = -2 Query: 315 NNINGWKR-LGLRVYKTTF*FSFKASYTYEHCKSH 214 N I G+++ LGLRV+ ++ S TYEH KSH Sbjct: 213 NGIFGFEKGLGLRVFASSLGLSIYLG-TYEHVKSH 246 >SPAC2C4.10c |||sequence orphan|Schizosaccharomyces pombe|chr 1|||Manual Length = 166 Score = 27.5 bits (58), Expect = 1.6 Identities = 11/26 (42%), Positives = 14/26 (53%) Frame = -3 Query: 188 RFYTNLKKCQEKYNFPSGRIYNMDET 111 R + ++ QEK F S R YN D T Sbjct: 32 RLFKTTQELQEKVKFSSSRFYNKDST 57 >SPAC12G12.16c ||SPAC18B11.01c|nuclease, XP-G family|Schizosaccharomyces pombe|chr 1|||Manual Length = 496 Score = 25.4 bits (53), Expect = 6.6 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = -3 Query: 185 FYTNLKKCQEKYNFPSGRIY 126 F NLK C NFP+G Y Sbjct: 116 FLCNLKNCLIDNNFPTGNFY 135 >SPCPB1C11.02 |||amino acid permease, unknown 16|Schizosaccharomyces pombe|chr 3|||Manual Length = 505 Score = 25.4 bits (53), Expect = 6.6 Identities = 11/25 (44%), Positives = 14/25 (56%) Frame = +2 Query: 119 PYYIFDLKGSYIFLDTFSSLYKIYL 193 PY I L G ++FL + SLY L Sbjct: 432 PYIIILLNGVFLFLQGYKSLYPFRL 456 >SPAC3A11.10c |||dipeptidyl aminopeptidase |Schizosaccharomyces pombe|chr 1|||Manual Length = 409 Score = 25.4 bits (53), Expect = 6.6 Identities = 26/110 (23%), Positives = 45/110 (40%), Gaps = 1/110 (0%) Frame = -3 Query: 353 FAEANEIENRFNKTT*MAGKDWVYEFIKRHSDLALKQATPTSIARAIGFNQVQVNRFYTN 174 FA+A R NK AG+D V E + + L TP ++ +A+ + +++ Sbjct: 214 FADAAVDGKRTNKGLSPAGRDIVREMNRLGMIVDLSHTTPETMHQALDVSVAPAFFSHSS 273 Query: 173 LKKCQE-KYNFPSGRIYNMDETGIVTVPKKTHKVISPKGKKKLIKLFLEN 27 K + N P + + ET V + ISP + I +E+ Sbjct: 274 AKGVYDHPRNVPDDVLIRVKETDGVVMVNFYPAFISPHPENATIDTVVEH 323 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,638,752 Number of Sequences: 5004 Number of extensions: 56705 Number of successful extensions: 129 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 126 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 129 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 271646730 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -