BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG1045 (627 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 02_04_0150 - 20215070-20217577 29 2.3 07_03_0423 + 18035688-18036572,18036659-18036978,18052618-180527... 28 5.3 >02_04_0150 - 20215070-20217577 Length = 835 Score = 29.5 bits (63), Expect = 2.3 Identities = 13/33 (39%), Positives = 20/33 (60%), Gaps = 3/33 (9%) Frame = -2 Query: 263 VNLYAVCIPIAI---NIYIRKYIYSIMIILLYC 174 V Y IP+A+ I+I + +S++ ILLYC Sbjct: 394 VEYYQAIIPLALPKPGIFIANFAFSVVFILLYC 426 >07_03_0423 + 18035688-18036572,18036659-18036978,18052618-18052724, 18053001-18053104,18054129-18054328,18054422-18054522, 18054695-18054841,18055007-18055166,18055287-18055368, 18056070-18056336,18056846-18056973,18057513-18057672 Length = 886 Score = 28.3 bits (60), Expect = 5.3 Identities = 12/31 (38%), Positives = 17/31 (54%) Frame = -2 Query: 227 NIYIRKYIYSIMIILLYCPYEEINICVDISN 135 N IR Y Y +++ LY PY N C + +N Sbjct: 809 NKSIRSYRYFVLLAKLYMPYAFFNACFNGTN 839 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,898,740 Number of Sequences: 37544 Number of extensions: 245993 Number of successful extensions: 363 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 360 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 363 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1525730988 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -