BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG1045 (627 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BT021229-1|AAX33377.1| 553|Drosophila melanogaster RH42588p pro... 30 2.2 AY060688-1|AAL28236.1| 512|Drosophila melanogaster GH12726p pro... 30 2.2 AE014297-1569|AAF54851.2| 553|Drosophila melanogaster CG12286-P... 30 2.2 >BT021229-1|AAX33377.1| 553|Drosophila melanogaster RH42588p protein. Length = 553 Score = 30.3 bits (65), Expect = 2.2 Identities = 12/46 (26%), Positives = 28/46 (60%), Gaps = 3/46 (6%) Frame = -2 Query: 257 LYAVCIPIAINIYIRKYIYSIMIILLYCPYEEINI---CVDISNYI 129 ++A+C+P+A+ Y Y++ + + P E++N+ C+ I++ I Sbjct: 301 IWALCVPLALFGYFVPYVHMMQFVKTTFPGEDVNLPVMCIGITSGI 346 >AY060688-1|AAL28236.1| 512|Drosophila melanogaster GH12726p protein. Length = 512 Score = 30.3 bits (65), Expect = 2.2 Identities = 12/46 (26%), Positives = 28/46 (60%), Gaps = 3/46 (6%) Frame = -2 Query: 257 LYAVCIPIAINIYIRKYIYSIMIILLYCPYEEINI---CVDISNYI 129 ++A+C+P+A+ Y Y++ + + P E++N+ C+ I++ I Sbjct: 260 IWALCVPLALFGYFVPYVHMMQFVKTTFPGEDVNLPVMCIGITSGI 305 >AE014297-1569|AAF54851.2| 553|Drosophila melanogaster CG12286-PA protein. Length = 553 Score = 30.3 bits (65), Expect = 2.2 Identities = 12/46 (26%), Positives = 28/46 (60%), Gaps = 3/46 (6%) Frame = -2 Query: 257 LYAVCIPIAINIYIRKYIYSIMIILLYCPYEEINI---CVDISNYI 129 ++A+C+P+A+ Y Y++ + + P E++N+ C+ I++ I Sbjct: 301 IWALCVPLALFGYFVPYVHMMQFVKTTFPGEDVNLPVMCIGITSGI 346 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 24,373,658 Number of Sequences: 53049 Number of extensions: 459600 Number of successful extensions: 696 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 683 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 696 length of database: 24,988,368 effective HSP length: 82 effective length of database: 20,638,350 effective search space used: 2600432100 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -