BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG1043 (634 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamat... 26 0.35 D79207-1|BAA23639.1| 432|Apis mellifera milk protein protein. 25 0.81 AF388203-1|AAM73637.1| 432|Apis mellifera major royal jelly pro... 25 0.81 AF000633-1|AAC61895.1| 432|Apis mellifera major royal jelly pro... 25 0.81 AB193550-1|BAD66824.1| 699|Apis mellifera soluble guanylyl cycl... 21 7.5 >AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamate receptor protein. Length = 1040 Score = 25.8 bits (54), Expect = 0.35 Identities = 15/57 (26%), Positives = 26/57 (45%), Gaps = 1/57 (1%) Frame = +2 Query: 443 LLDEESIAKAVRYSNVVINLVGRDYETKNFKY-NDVHVDGVRRIARICREEGVERFI 610 L+ + +AK Y N+V+ L+ + + +D V GV R + C G +I Sbjct: 317 LVKDSGVAKDAAYDNIVLKLLTKPRARGCIIFGSDQEVAGVMRAVKRCNATGAFSWI 373 Score = 21.4 bits (43), Expect = 7.5 Identities = 9/30 (30%), Positives = 17/30 (56%) Frame = +3 Query: 288 FSVAPDLSDAMCATNWEKLVPS*FYHTEAI 377 FS +P+LS+ + + +PS Y +A+ Sbjct: 242 FSTSPELSNKQRFEYFTRTIPSDHYQVKAM 271 >D79207-1|BAA23639.1| 432|Apis mellifera milk protein protein. Length = 432 Score = 24.6 bits (51), Expect = 0.81 Identities = 7/19 (36%), Positives = 14/19 (73%) Frame = +2 Query: 515 YETKNFKYNDVHVDGVRRI 571 + T +++ ND+H +GV+ I Sbjct: 283 FRTSDYQQNDIHYEGVQNI 301 >AF388203-1|AAM73637.1| 432|Apis mellifera major royal jelly protein MRJP1 protein. Length = 432 Score = 24.6 bits (51), Expect = 0.81 Identities = 7/19 (36%), Positives = 14/19 (73%) Frame = +2 Query: 515 YETKNFKYNDVHVDGVRRI 571 + T +++ ND+H +GV+ I Sbjct: 283 FRTSDYQQNDIHYEGVQNI 301 >AF000633-1|AAC61895.1| 432|Apis mellifera major royal jelly protein MRJP1 protein. Length = 432 Score = 24.6 bits (51), Expect = 0.81 Identities = 7/19 (36%), Positives = 14/19 (73%) Frame = +2 Query: 515 YETKNFKYNDVHVDGVRRI 571 + T +++ ND+H +GV+ I Sbjct: 283 FRTSDYQQNDIHYEGVQNI 301 >AB193550-1|BAD66824.1| 699|Apis mellifera soluble guanylyl cyclase alpha 1 subunit protein. Length = 699 Score = 21.4 bits (43), Expect = 7.5 Identities = 11/30 (36%), Positives = 14/30 (46%) Frame = -3 Query: 416 LNLRTLSTFGHHRNRLCMVKLTGYQFFPIC 327 L + + FGHH NRL T + F C Sbjct: 310 LGVGFMRIFGHHLNRLGREISTYFTFTRPC 339 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 170,522 Number of Sequences: 438 Number of extensions: 3130 Number of successful extensions: 6 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 18949215 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -