BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG1041 (364 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY063776-1|AAL59658.1| 224|Anopheles gambiae glutathione S-tran... 26 0.38 AY056833-1|AAL23627.1| 1253|Anopheles gambiae chitin synthase pr... 22 6.2 >AY063776-1|AAL59658.1| 224|Anopheles gambiae glutathione S-transferase E1 protein. Length = 224 Score = 26.2 bits (55), Expect = 0.38 Identities = 16/46 (34%), Positives = 27/46 (58%), Gaps = 2/46 (4%) Frame = +2 Query: 191 QFPDDLLEVSCKVYKEIKDRIEVDLYIMGD-TSYASCS-IDSVAAM 322 + P+D +E K Y+ ++D ++ D Y+ G + A S I SVA+M Sbjct: 128 EIPEDRIEYVRKAYRLLEDSLQTD-YVAGSRLTIADLSCISSVASM 172 >AY056833-1|AAL23627.1| 1253|Anopheles gambiae chitin synthase protein. Length = 1253 Score = 22.2 bits (45), Expect = 6.2 Identities = 10/32 (31%), Positives = 14/32 (43%) Frame = -1 Query: 109 TFSFIYCYLTCYTYFVFCSKIPHFIFDIVFQL 14 T + I C CY + F KI F + F + Sbjct: 35 TVTHILCAYLCYIFSKFACKIQIQSFSMAFPI 66 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 398,710 Number of Sequences: 2352 Number of extensions: 7714 Number of successful extensions: 4 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 563,979 effective HSP length: 57 effective length of database: 429,915 effective search space used: 27084645 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -