BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG1041 (364 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF393497-1|AAL60422.1| 143|Apis mellifera odorant binding prote... 21 4.5 AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor pr... 21 5.9 AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter... 20 7.8 AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter... 20 7.8 AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precurso... 20 7.8 >AF393497-1|AAL60422.1| 143|Apis mellifera odorant binding protein ASP5 protein. Length = 143 Score = 21.0 bits (42), Expect = 4.5 Identities = 13/31 (41%), Positives = 16/31 (51%), Gaps = 1/31 (3%) Frame = -1 Query: 97 IYCYLTCYTYFVFCSKIPHFIFD-IVFQLMI 8 + CY TC + K +F FD IV QL I Sbjct: 65 LQCYTTCIMKLLRTFKNGNFDFDMIVKQLEI 95 >AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor protein. Length = 1370 Score = 20.6 bits (41), Expect = 5.9 Identities = 10/35 (28%), Positives = 19/35 (54%) Frame = +2 Query: 233 KEIKDRIEVDLYIMGDTSYASCSIDSVAAMHVQAN 337 K +DR + YI G+ +CS+D + ++ Q + Sbjct: 665 KVAEDRPLPEFYIGGNPFNCNCSMDWLPGINNQTS 699 >AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 593 Score = 20.2 bits (40), Expect = 7.8 Identities = 9/20 (45%), Positives = 12/20 (60%) Frame = +3 Query: 267 ILWEIHHMLAVV*ILWQLCM 326 I WE+ LAVV I+ C+ Sbjct: 205 IRWELAGTLAVVWIMCYFCI 224 >AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 646 Score = 20.2 bits (40), Expect = 7.8 Identities = 9/20 (45%), Positives = 12/20 (60%) Frame = +3 Query: 267 ILWEIHHMLAVV*ILWQLCM 326 I WE+ LAVV I+ C+ Sbjct: 258 IRWELAGTLAVVWIMCYFCI 277 >AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precursor protein. Length = 1770 Score = 20.2 bits (40), Expect = 7.8 Identities = 8/18 (44%), Positives = 10/18 (55%) Frame = +2 Query: 56 TEDKICITREITVNKTEG 109 T+DKIC T V+ G Sbjct: 1697 TDDKICFTMRPVVSCASG 1714 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 106,643 Number of Sequences: 438 Number of extensions: 2180 Number of successful extensions: 8 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 146,343 effective HSP length: 51 effective length of database: 124,005 effective search space used: 8556345 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 39 (20.8 bits)
- SilkBase 1999-2023 -