BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG1040 (611 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q8A3S2 Cluster: Glycosyltransferase; n=1; Bacteroides t... 33 5.3 UniRef50_Q7RTA2 Cluster: Putative uncharacterized protein PY0009... 33 7.1 >UniRef50_Q8A3S2 Cluster: Glycosyltransferase; n=1; Bacteroides thetaiotaomicron|Rep: Glycosyltransferase - Bacteroides thetaiotaomicron Length = 323 Score = 33.1 bits (72), Expect = 5.3 Identities = 18/54 (33%), Positives = 28/54 (51%) Frame = -1 Query: 491 FNYTHRCNMSYKVSKYCCSYVQLRFVLGV*RYFFTLYRMLHKCDNEFFDIIRYC 330 F C+M +++K S+ LRFVL + +F L+ C NEF+ I +C Sbjct: 266 FLVVKECSMFMRITKILISHFGLRFVLRM--WFDRLFLNKKLCVNEFYQIKDFC 317 >UniRef50_Q7RTA2 Cluster: Putative uncharacterized protein PY00092; n=7; Plasmodium (Vinckeia)|Rep: Putative uncharacterized protein PY00092 - Plasmodium yoelii yoelii Length = 1841 Score = 32.7 bits (71), Expect = 7.1 Identities = 19/60 (31%), Positives = 32/60 (53%) Frame = +3 Query: 282 EFLFHILFINYTNY*ITISNYVKKFIITFM*HSVQSKKIPSYS*YKAKLHIRATIF*YFI 461 EF L++NY +Y +SN+ KK+II ++ + + K+ YS K K + YF+ Sbjct: 1220 EFPNLFLYLNYKSYNYLLSNFDKKYIIYYLFDNPKYLKMYFYSLLKKKKLEHCLVALYFL 1279 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 497,285,750 Number of Sequences: 1657284 Number of extensions: 8813969 Number of successful extensions: 19192 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 18510 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 19190 length of database: 575,637,011 effective HSP length: 97 effective length of database: 414,880,463 effective search space used: 43977329078 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -