BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG1040 (611 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 11_06_0037 - 19478885-19480472,19483125-19483267 30 1.7 08_01_0889 + 8753877-8754236,8754995-8755054,8755174-8755250,875... 30 1.7 09_06_0260 - 21911358-21911438,21911715-21911828,21911911-219120... 28 6.7 07_03_0124 - 13723597-13724657,13726179-13726413 28 6.7 03_02_0568 + 9514715-9514944,9515174-9515300,9515529-9515684,951... 27 8.9 >11_06_0037 - 19478885-19480472,19483125-19483267 Length = 576 Score = 29.9 bits (64), Expect = 1.7 Identities = 14/43 (32%), Positives = 23/43 (53%) Frame = +2 Query: 89 FTALVGYRVLTILGRNIHFPEYKFLTSRRYNSLVQVPIYKETK 217 F A GYR +LGRN F +++ ++R + LV + E + Sbjct: 32 FEAATGYRADEVLGRNCRFLQFRDPRAQRRHPLVDPMVVSEIR 74 >08_01_0889 + 8753877-8754236,8754995-8755054,8755174-8755250, 8755481-8755622,8755736-8755772,8755852-8755921, 8756021-8756212,8756321-8756413,8756545-8756773, 8756861-8756944,8757041-8757192,8757279-8757375, 8757576-8757725,8757813-8757890,8757982-8758104, 8758169-8758315,8758418-8758472,8758807-8758874 Length = 737 Score = 29.9 bits (64), Expect = 1.7 Identities = 11/24 (45%), Positives = 16/24 (66%) Frame = +1 Query: 364 HLCNILYKVKKYLHTPSTKRSCTY 435 H C V++ LHTP++ RSCT+ Sbjct: 310 HPCRANVAVRRELHTPASDRSCTH 333 >09_06_0260 - 21911358-21911438,21911715-21911828,21911911-21912033, 21912342-21912419,21912498-21912647,21913505-21913601, 21913679-21913860,21913899-21913982,21914243-21914303, 21914414-21914506,21914588-21914782,21914937-21915006, 21915536-21915572,21915654-21915737,21915828-21915885, 21916008-21916084,21916185-21916244,21916325-21916687 Length = 668 Score = 27.9 bits (59), Expect = 6.7 Identities = 10/26 (38%), Positives = 16/26 (61%) Frame = +1 Query: 358 LSHLCNILYKVKKYLHTPSTKRSCTY 435 + H C V++ LHTP++ RSC + Sbjct: 310 IQHPCRANVAVRRELHTPASYRSCIH 335 >07_03_0124 - 13723597-13724657,13726179-13726413 Length = 431 Score = 27.9 bits (59), Expect = 6.7 Identities = 10/29 (34%), Positives = 19/29 (65%) Frame = -2 Query: 262 IILTAYCINGCIPCVFGFFVNGYLY*AVV 176 ++L++ C GC +F FF +G ++ A+V Sbjct: 346 VLLSSQCPPGCEGSLFAFFTSGLVFSAIV 374 >03_02_0568 + 9514715-9514944,9515174-9515300,9515529-9515684, 9515765-9516102,9516191-9516329,9517083-9517152, 9517201-9517307,9517387-9517437,9517549-9517660, 9517783-9517869,9517958-9518133,9518479-9518586, 9518654-9518812,9518888-9518971,9519053-9519258, 9519565-9519666,9519768-9519877,9519963-9520114, 9520380-9520548,9520841-9520878,9521963-9522571, 9523314-9523784,9523786-9523871,9524396-9524906, 9525388-9525412,9526001-9526051,9526228-9526301, 9526412-9526534,9526667-9526738,9526924-9527020, 9527174-9527283 Length = 1649 Score = 27.5 bits (58), Expect = 8.9 Identities = 9/22 (40%), Positives = 16/22 (72%), Gaps = 1/22 (4%) Frame = -2 Query: 259 ILTAYCI-NGCIPCVFGFFVNG 197 ++ A C+ N C+PC++GF + G Sbjct: 1253 LVVASCLKNSCVPCIYGFGLFG 1274 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,594,394 Number of Sequences: 37544 Number of extensions: 207907 Number of successful extensions: 337 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 335 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 337 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1466594128 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -