BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG1040 (611 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY350618-1|AAQ57660.1| 425|Apis mellifera complementary sex det... 26 0.33 DQ071552-1|AAY82248.1| 495|Apis mellifera anarchy 1 protein. 23 2.4 L01589-1|AAA27736.1| 81|Apis mellifera zinc finger protein pro... 23 3.1 DQ667186-1|ABG75738.1| 447|Apis mellifera glutamate-gated chlor... 21 7.2 DQ667185-1|ABG75737.1| 447|Apis mellifera glutamate-gated chlor... 21 7.2 >AY350618-1|AAQ57660.1| 425|Apis mellifera complementary sex determiner protein. Length = 425 Score = 25.8 bits (54), Expect = 0.33 Identities = 12/37 (32%), Positives = 20/37 (54%) Frame = -1 Query: 536 KQSTF*SE*NNYVLFFNYTHRCNMSYKVSKYCCSYVQ 426 K S + + NNY + NY + N +YK Y +Y++ Sbjct: 323 KYSNYNNYNNNYNNYNNYNNNYNNNYKKLYYNINYIE 359 >DQ071552-1|AAY82248.1| 495|Apis mellifera anarchy 1 protein. Length = 495 Score = 23.0 bits (47), Expect = 2.4 Identities = 15/46 (32%), Positives = 21/46 (45%) Frame = +2 Query: 146 PEYKFLTSRRYNSLVQVPIYKETKNTRYTTVNTISCKNNKVYLVKR 283 PE+ + SLV T TT TIS K+ KV++V + Sbjct: 365 PEFGSIYFLGNYSLVPTTTASPTTEPSTTTSTTISQKHIKVFVVNK 410 >L01589-1|AAA27736.1| 81|Apis mellifera zinc finger protein protein. Length = 81 Score = 22.6 bits (46), Expect = 3.1 Identities = 9/23 (39%), Positives = 14/23 (60%) Frame = -3 Query: 564 KDSFSCAQTQAIYVLIGMKQLCI 496 K SFSC + +YV +G ++ I Sbjct: 14 KKSFSCKYCEKVYVSLGALKMHI 36 >DQ667186-1|ABG75738.1| 447|Apis mellifera glutamate-gated chloride channel protein. Length = 447 Score = 21.4 bits (43), Expect = 7.2 Identities = 10/35 (28%), Positives = 13/35 (37%) Frame = -1 Query: 485 YTHRCNMSYKVSKYCCSYVQLRFVLGV*RYFFTLY 381 +T CN +Y C V L F Y +Y Sbjct: 215 FTDYCNSKTNTGEYSCLKVDLLFKREFSYYLIQIY 249 >DQ667185-1|ABG75737.1| 447|Apis mellifera glutamate-gated chloride channel protein. Length = 447 Score = 21.4 bits (43), Expect = 7.2 Identities = 10/35 (28%), Positives = 13/35 (37%) Frame = -1 Query: 485 YTHRCNMSYKVSKYCCSYVQLRFVLGV*RYFFTLY 381 +T CN +Y C V L F Y +Y Sbjct: 215 FTDYCNSKTNTGEYSCLKVDLLFKREFSYYLIQIY 249 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 154,895 Number of Sequences: 438 Number of extensions: 3590 Number of successful extensions: 6 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 18093444 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -