BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG1036 (663 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_59530| Best HMM Match : NAC (HMM E-Value=4.6e-05) 60 2e-09 SB_26449| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_53017| Best HMM Match : Kazal_1 (HMM E-Value=0) 28 5.9 >SB_59530| Best HMM Match : NAC (HMM E-Value=4.6e-05) Length = 98 Score = 60.1 bits (139), Expect = 2e-09 Identities = 27/33 (81%), Positives = 28/33 (84%) Frame = +2 Query: 263 VNTIPGIEEVNMIKEDGTVIHFNNPKAQASLAA 361 VN IPGIEEVNMIKEDGTVIHFNNPKA+ A Sbjct: 54 VNPIPGIEEVNMIKEDGTVIHFNNPKAEMGSGA 86 >SB_26449| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 41 Score = 33.1 bits (72), Expect = 0.21 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = +2 Query: 500 EEDDEVPNLVGNFDEASK 553 +EDDEVP LV NFDE SK Sbjct: 10 DEDDEVPELVENFDEPSK 27 >SB_53017| Best HMM Match : Kazal_1 (HMM E-Value=0) Length = 1488 Score = 28.3 bits (60), Expect = 5.9 Identities = 11/27 (40%), Positives = 15/27 (55%), Gaps = 1/27 (3%) Frame = -2 Query: 191 CVSVCP-YRRCVLATGVSLIFRCSFCC 114 C S+C Y RCV+ V++ CS C Sbjct: 639 CTSICHRYGRCVMLANVTMFCNCSRAC 665 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,173,836 Number of Sequences: 59808 Number of extensions: 359321 Number of successful extensions: 956 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 886 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 954 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1705624125 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -