BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG1036 (663 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U29488-6|AAA68776.1| 161|Caenorhabditis elegans Inhibitor of ce... 186 2e-47 U42835-2|AAA83586.1| 617|Caenorhabditis elegans Chitinase prote... 31 0.96 AF100669-1|AAK39265.1| 931|Caenorhabditis elegans Hypothetical ... 29 3.9 >U29488-6|AAA68776.1| 161|Caenorhabditis elegans Inhibitor of cell death protein 1 protein. Length = 161 Score = 186 bits (452), Expect = 2e-47 Identities = 92/152 (60%), Positives = 113/152 (74%), Gaps = 5/152 (3%) Frame = +2 Query: 113 NSRMNSEKLKKLQSQ---VRIGGKGTPRRKKKVVHVTAATDDXXXXXXXXXXXVNTIPGI 283 +S+ +E++KKLQ+Q VRIGGKGTPRRKKKV+H TAA DD V IPGI Sbjct: 2 DSKAIAERIKKLQAQQEHVRIGGKGTPRRKKKVIHKTAAADDKKLQSNLKKLSVTNIPGI 61 Query: 284 EEVNMIKEDGTVIHFNNPKAQASLAANTFAITGHGENKQTTEMLPGILSQLGPDGLNRLK 463 EEVNMIK+DGTVIHFNNPK Q S+ ANTF++TG +NKQ TEMLPGIL+QLGP+ L LK Sbjct: 62 EEVNMIKDDGTVIHFNNPKVQTSVPANTFSVTGSADNKQITEMLPGILNQLGPESLTHLK 121 Query: 464 RIASSVA--APKPLEEDDEVPNLVGNFDEASK 553 ++A++V P ED++VP LVG+FD ASK Sbjct: 122 KLANNVTKLGPDGKGEDEDVPELVGDFDAASK 153 >U42835-2|AAA83586.1| 617|Caenorhabditis elegans Chitinase protein 1 protein. Length = 617 Score = 30.7 bits (66), Expect = 0.96 Identities = 14/38 (36%), Positives = 21/38 (55%) Frame = +2 Query: 428 SQLGPDGLNRLKRIASSVAAPKPLEEDDEVPNLVGNFD 541 S+ G G +RL A+ A P ++ ++PNL NFD Sbjct: 203 SEAGSTGKDRLLVTAAVAAGPATIDAGYDIPNLAPNFD 240 >AF100669-1|AAK39265.1| 931|Caenorhabditis elegans Hypothetical protein R11E3.3 protein. Length = 931 Score = 28.7 bits (61), Expect = 3.9 Identities = 10/25 (40%), Positives = 16/25 (64%) Frame = +1 Query: 238 AVIAQKVVSEHNSWHRRGKYDQRGR 312 ++I+ V + H++WH G D RGR Sbjct: 34 SIISGDVNAHHSAWHSEGSEDTRGR 58 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,187,311 Number of Sequences: 27780 Number of extensions: 264788 Number of successful extensions: 711 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 681 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 710 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1486926498 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -