BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG1031 (668 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY061621-1|AAL29169.2| 306|Drosophila melanogaster SD09294p pro... 96 3e-20 AE014296-713|AAF47807.1| 302|Drosophila melanogaster CG10849-PA... 96 3e-20 AY069370-1|AAL39515.1| 863|Drosophila melanogaster LD07688p pro... 31 1.4 AE014297-2741|AAF55729.1| 863|Drosophila melanogaster CG12254-P... 31 1.4 >AY061621-1|AAL29169.2| 306|Drosophila melanogaster SD09294p protein. Length = 306 Score = 96.3 bits (229), Expect = 3e-20 Identities = 37/62 (59%), Positives = 49/62 (79%) Frame = -2 Query: 667 NFVSCPNYTYEFGSWLFFTIMTKCAPAGLFAAAGFYQMAVWAIGKHRNYKKEFPDYPKGR 488 + VSCPNYTYE G+W+ F+++T C A LFA AG +QM +WA+ KHRNYKKEF DYP+ R Sbjct: 239 DLVSCPNYTYEIGAWVSFSVLTSCLAAYLFAFAGAFQMTIWALAKHRNYKKEFKDYPRQR 298 Query: 487 KA 482 ++ Sbjct: 299 RS 300 >AE014296-713|AAF47807.1| 302|Drosophila melanogaster CG10849-PA protein. Length = 302 Score = 96.3 bits (229), Expect = 3e-20 Identities = 37/62 (59%), Positives = 49/62 (79%) Frame = -2 Query: 667 NFVSCPNYTYEFGSWLFFTIMTKCAPAGLFAAAGFYQMAVWAIGKHRNYKKEFPDYPKGR 488 + VSCPNYTYE G+W+ F+++T C A LFA AG +QM +WA+ KHRNYKKEF DYP+ R Sbjct: 235 DLVSCPNYTYEIGAWVSFSVLTSCLAAYLFAFAGAFQMTIWALAKHRNYKKEFKDYPRQR 294 Query: 487 KA 482 ++ Sbjct: 295 RS 296 >AY069370-1|AAL39515.1| 863|Drosophila melanogaster LD07688p protein. Length = 863 Score = 31.1 bits (67), Expect = 1.4 Identities = 18/67 (26%), Positives = 30/67 (44%) Frame = +3 Query: 276 KNHCPLICHPIPTKAPTNTYSIYRNYQCQYL*IFCLTITYKRIRINILLVATRSIIKLSN 455 + HC LIC+ P + PT Y C+ L + +IN+ ++A R + L Sbjct: 135 QRHCILICNSPPYQMPTTESWKYPGKSCEQ-----LAALFNERKINLSIIAPRKMPVLFK 189 Query: 456 LIYRMNG 476 L + +G Sbjct: 190 LFMKADG 196 >AE014297-2741|AAF55729.1| 863|Drosophila melanogaster CG12254-PA protein. Length = 863 Score = 31.1 bits (67), Expect = 1.4 Identities = 18/67 (26%), Positives = 30/67 (44%) Frame = +3 Query: 276 KNHCPLICHPIPTKAPTNTYSIYRNYQCQYL*IFCLTITYKRIRINILLVATRSIIKLSN 455 + HC LIC+ P + PT Y C+ L + +IN+ ++A R + L Sbjct: 135 QRHCILICNSPPYQMPTTESWKYPGKSCEQ-----LAALFNERKINLSIIAPRKMPVLFK 189 Query: 456 LIYRMNG 476 L + +G Sbjct: 190 LFMKADG 196 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 26,023,077 Number of Sequences: 53049 Number of extensions: 520354 Number of successful extensions: 1251 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1211 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1251 length of database: 24,988,368 effective HSP length: 82 effective length of database: 20,638,350 effective search space used: 2889369000 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -