BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG1030 (665 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_17617| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_57691| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_6465| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_2383| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_27342| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_58054| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 5e-09 SB_1204| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 7e-06 SB_33624| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 7e-06 SB_6881| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 8e-05 SB_26327| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_1546| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_13730| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_46164| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.37 SB_13374| Best HMM Match : Cornifin (HMM E-Value=0.34) 29 2.6 SB_59756| Best HMM Match : cNMP_binding (HMM E-Value=5.7e-21) 29 3.4 SB_35396| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.9 SB_35857| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.9 SB_28850| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.9 SB_19517| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.9 SB_15898| Best HMM Match : Fork_head (HMM E-Value=0) 28 7.9 >SB_17617| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 67.3 bits (157), Expect = 1e-11 Identities = 32/40 (80%), Positives = 34/40 (85%) Frame = +1 Query: 154 SWIVARRTSAKAFAKGVFINQERKLEVRRRLDTALVLTVN 273 SWI RRT+AKAFAK VFINQERKLE RRR DT LVLT+N Sbjct: 4 SWIYERRTTAKAFAKNVFINQERKLEDRRRSDTVLVLTIN 43 >SB_57691| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 60.5 bits (140), Expect = 1e-09 Identities = 29/35 (82%), Positives = 31/35 (88%) Frame = +1 Query: 169 RRTSAKAFAKGVFINQERKLEVRRRLDTALVLTVN 273 RRT+AKAFAK VFINQERKLE RRR DT LVLT+N Sbjct: 9 RRTTAKAFAKNVFINQERKLEDRRRSDTVLVLTIN 43 >SB_6465| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 60.5 bits (140), Expect = 1e-09 Identities = 29/35 (82%), Positives = 31/35 (88%) Frame = +1 Query: 169 RRTSAKAFAKGVFINQERKLEVRRRLDTALVLTVN 273 RRT+AKAFAK VFINQERKLE RRR DT LVLT+N Sbjct: 9 RRTTAKAFAKNVFINQERKLEDRRRSDTVLVLTIN 43 >SB_2383| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 60.5 bits (140), Expect = 1e-09 Identities = 29/35 (82%), Positives = 31/35 (88%) Frame = +1 Query: 169 RRTSAKAFAKGVFINQERKLEVRRRLDTALVLTVN 273 RRT+AKAFAK VFINQERKLE RRR DT LVLT+N Sbjct: 9 RRTTAKAFAKNVFINQERKLEDRRRSDTVLVLTIN 43 >SB_27342| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 48 Score = 60.5 bits (140), Expect = 1e-09 Identities = 29/35 (82%), Positives = 31/35 (88%) Frame = +1 Query: 169 RRTSAKAFAKGVFINQERKLEVRRRLDTALVLTVN 273 RRT+AKAFAK VFINQERKLE RRR DT LVLT+N Sbjct: 11 RRTTAKAFAKNVFINQERKLEDRRRSDTVLVLTIN 45 >SB_58054| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 58.4 bits (135), Expect = 5e-09 Identities = 28/34 (82%), Positives = 30/34 (88%) Frame = +1 Query: 172 RTSAKAFAKGVFINQERKLEVRRRLDTALVLTVN 273 RT+AKAFAK VFINQERKLE RRR DT LVLT+N Sbjct: 29 RTTAKAFAKNVFINQERKLEDRRRSDTVLVLTIN 62 >SB_1204| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 48.0 bits (109), Expect = 7e-06 Identities = 23/27 (85%), Positives = 24/27 (88%) Frame = +1 Query: 172 RTSAKAFAKGVFINQERKLEVRRRLDT 252 RT+AKAFAK VFINQERKLE RRR DT Sbjct: 2 RTTAKAFAKNVFINQERKLEDRRRSDT 28 >SB_33624| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 48.0 bits (109), Expect = 7e-06 Identities = 24/36 (66%), Positives = 29/36 (80%), Gaps = 1/36 (2%) Frame = +1 Query: 169 RRTS-AKAFAKGVFINQERKLEVRRRLDTALVLTVN 273 R+T+ ++ AK VFINQERKLE RRR DT LVLT+N Sbjct: 8 RKTNYCESIAKNVFINQERKLEDRRRSDTVLVLTIN 43 Score = 29.5 bits (63), Expect = 2.6 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = +3 Query: 147 VKFLDRRKTNISESICQRCFHQSRTKV 227 VKFLD RKTN ESI + F K+ Sbjct: 2 VKFLDLRKTNYCESIAKNVFINQERKL 28 >SB_6881| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 44.4 bits (100), Expect = 8e-05 Identities = 22/36 (61%), Positives = 28/36 (77%), Gaps = 1/36 (2%) Frame = +1 Query: 169 RRTS-AKAFAKGVFINQERKLEVRRRLDTALVLTVN 273 R+T+ ++ + VFINQERKLE RRR DT LVLT+N Sbjct: 8 RKTNYCESICQDVFINQERKLEDRRRSDTVLVLTIN 43 Score = 33.9 bits (74), Expect = 0.12 Identities = 16/27 (59%), Positives = 17/27 (62%) Frame = +3 Query: 147 VKFLDRRKTNISESICQRCFHQSRTKV 227 VKFLD RKTN ESICQ F K+ Sbjct: 2 VKFLDLRKTNYCESICQDVFINQERKL 28 >SB_26327| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 41.9 bits (94), Expect = 5e-04 Identities = 21/36 (58%), Positives = 27/36 (75%), Gaps = 1/36 (2%) Frame = +1 Query: 169 RRTS-AKAFAKGVFINQERKLEVRRRLDTALVLTVN 273 R+T+ ++ + FINQERKLE RRR DT LVLT+N Sbjct: 8 RKTNYCESICQECFINQERKLEDRRRSDTVLVLTIN 43 Score = 29.9 bits (64), Expect = 1.9 Identities = 13/26 (50%), Positives = 15/26 (57%) Frame = +3 Query: 150 KFLDRRKTNISESICQRCFHQSRTKV 227 + L RKTN ESICQ CF K+ Sbjct: 3 EILGFRKTNYCESICQECFINQERKL 28 >SB_1546| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 41.9 bits (94), Expect = 5e-04 Identities = 21/36 (58%), Positives = 27/36 (75%), Gaps = 1/36 (2%) Frame = +1 Query: 169 RRTS-AKAFAKGVFINQERKLEVRRRLDTALVLTVN 273 R+T+ ++ + FINQERKLE RRR DT LVLT+N Sbjct: 8 RKTNYCESICQECFINQERKLEDRRRSDTVLVLTIN 43 Score = 38.7 bits (86), Expect = 0.004 Identities = 17/27 (62%), Positives = 18/27 (66%) Frame = +3 Query: 147 VKFLDRRKTNISESICQRCFHQSRTKV 227 VKFLD RKTN ESICQ CF K+ Sbjct: 2 VKFLDLRKTNYCESICQECFINQERKL 28 >SB_13730| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 41.9 bits (94), Expect = 5e-04 Identities = 21/36 (58%), Positives = 27/36 (75%), Gaps = 1/36 (2%) Frame = +1 Query: 169 RRTS-AKAFAKGVFINQERKLEVRRRLDTALVLTVN 273 R+T+ ++ + FINQERKLE RRR DT LVLT+N Sbjct: 8 RKTNYCESICQECFINQERKLEDRRRSDTVLVLTIN 43 Score = 38.7 bits (86), Expect = 0.004 Identities = 17/27 (62%), Positives = 18/27 (66%) Frame = +3 Query: 147 VKFLDRRKTNISESICQRCFHQSRTKV 227 VKFLD RKTN ESICQ CF K+ Sbjct: 2 VKFLDLRKTNYCESICQECFINQERKL 28 >SB_46164| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 784 Score = 32.3 bits (70), Expect = 0.37 Identities = 22/60 (36%), Positives = 31/60 (51%), Gaps = 1/60 (1%) Frame = -3 Query: 480 CQSFRCPGLVRFPELSQIKPQ-APLLVVPFRQFL*VSALQPYSPRSPKSLVSRKLPAEPL 304 C S +CPG V +P + P+ AP P R++ L SPRSP++ SR P E + Sbjct: 343 CASGKCPGCVYYPGMVPRSPRDAP--KEP-REYASPPPLPSKSPRSPRTSESRSPPREEM 399 >SB_13374| Best HMM Match : Cornifin (HMM E-Value=0.34) Length = 1197 Score = 29.5 bits (63), Expect = 2.6 Identities = 16/36 (44%), Positives = 19/36 (52%) Frame = -2 Query: 469 PVSGPGEISRVESN*AAGSTPGGALPSIPLSFSFAT 362 P S PG S A STPG A+ SIP + S +T Sbjct: 1015 PSSTPGAASSTTPGAAPSSTPGAAMSSIPGATSSST 1050 >SB_59756| Best HMM Match : cNMP_binding (HMM E-Value=5.7e-21) Length = 858 Score = 29.1 bits (62), Expect = 3.4 Identities = 20/60 (33%), Positives = 28/60 (46%), Gaps = 3/60 (5%) Frame = +1 Query: 349 PGGVWLQS*NLKELTEGHHQEWSLRLNLTQ---LGKSHQARTPEGLTD*QLFLDSVGGGA 519 P W+ + NLK + G WSL L+ +G H P+ LTD L + S+ GA Sbjct: 475 PDDSWVSTSNLKTASPGEQYSWSLFRALSHMLCIGYGHY--PPQNLTDLWLTVCSMTAGA 532 >SB_35396| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 53 Score = 28.3 bits (60), Expect = 5.9 Identities = 13/38 (34%), Positives = 22/38 (57%), Gaps = 1/38 (2%) Frame = +2 Query: 86 QNSEVMINRDNWGHSY-CDVRGEILGSSQDEHQRKHLP 196 Q EV +++ GH Y C GE++ S++D H+ +P Sbjct: 7 QCKEVESSKEILGHPYVCAFAGEVIQSTEDVHKPSWIP 44 >SB_35857| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2680 Score = 27.9 bits (59), Expect = 7.9 Identities = 14/31 (45%), Positives = 18/31 (58%) Frame = -1 Query: 368 CNHTPPGVQNLWFPGSCPPSHCSNVGGSLDD 276 C+ PG + PGSC P +C N+ GSL D Sbjct: 854 CDRCMPG--SYGGPGSCKPCNC-NMAGSLSD 881 >SB_28850| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 681 Score = 27.9 bits (59), Expect = 7.9 Identities = 17/42 (40%), Positives = 23/42 (54%), Gaps = 2/42 (4%) Frame = -3 Query: 456 LVRFPELSQIKPQAPLL--VVPFRQFL*VSALQPYSPRSPKS 337 L R LS + P + + VVPFR + + L P+ P SPKS Sbjct: 39 LHRLESLSILSPASAAVEDVVPFRGDVFAAGLVPHPPDSPKS 80 >SB_19517| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1696 Score = 27.9 bits (59), Expect = 7.9 Identities = 11/30 (36%), Positives = 17/30 (56%) Frame = -1 Query: 335 WFPGSCPPSHCSNVGGSLDDIFTVRTRAVS 246 W+PG CPP C+ +L + TV + +S Sbjct: 80 WYPGYCPPHKCAG-RNTLQECCTVYSPEIS 108 >SB_15898| Best HMM Match : Fork_head (HMM E-Value=0) Length = 460 Score = 27.9 bits (59), Expect = 7.9 Identities = 12/25 (48%), Positives = 17/25 (68%), Gaps = 1/25 (4%) Frame = -1 Query: 359 TPPGV-QNLWFPGSCPPSHCSNVGG 288 +P GV +N W PGS S+C++ GG Sbjct: 174 SPYGVDENSWSPGSSQSSNCTSPGG 198 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,854,278 Number of Sequences: 59808 Number of extensions: 476622 Number of successful extensions: 1114 Number of sequences better than 10.0: 20 Number of HSP's better than 10.0 without gapping: 1016 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1113 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1717720750 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -