BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG1028 (660 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292363-1|CAL23175.2| 347|Tribolium castaneum gustatory recept... 25 0.55 AY600513-1|AAT11861.1| 314|Tribolium castaneum spalt-like prote... 22 5.1 >AM292363-1|CAL23175.2| 347|Tribolium castaneum gustatory receptor candidate 42 protein. Length = 347 Score = 25.0 bits (52), Expect = 0.55 Identities = 18/49 (36%), Positives = 23/49 (46%) Frame = -2 Query: 260 HFLRRLAEYVVLCFQSNFTYFL*FNKTANRNGFFLIFILKTSDPPSLRF 114 +F LAE V L FQ +TYFL R + I +L T + RF Sbjct: 141 YFREYLAEAVQLYFQFYYTYFLCVIVCIFRGKYRNINLLLTEQLQNRRF 189 >AY600513-1|AAT11861.1| 314|Tribolium castaneum spalt-like protein protein. Length = 314 Score = 21.8 bits (44), Expect = 5.1 Identities = 9/20 (45%), Positives = 12/20 (60%) Frame = -1 Query: 447 GNIKTHMKMQNQALPCLVLN 388 GN+KTHM + P VL+ Sbjct: 176 GNLKTHMGVHRAKPPMRVLH 195 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 151,181 Number of Sequences: 336 Number of extensions: 3472 Number of successful extensions: 5 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 17073220 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -