BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG1028 (660 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_8146| Best HMM Match : efhand (HMM E-Value=1.2e-16) 29 4.4 SB_6552| Best HMM Match : Glyco_transf_9 (HMM E-Value=1.9) 28 5.9 >SB_8146| Best HMM Match : efhand (HMM E-Value=1.2e-16) Length = 285 Score = 28.7 bits (61), Expect = 4.4 Identities = 14/42 (33%), Positives = 21/42 (50%) Frame = -3 Query: 211 ISHISSSLTKLQTEMAFSLFLY*RLATRPRFASETLNFIINN 86 + H+S TKL + SL Y L +F+ E L I++N Sbjct: 166 VQHVSKRSTKLWPNASISLLRYRHLQVAAKFSREILFSIVHN 207 >SB_6552| Best HMM Match : Glyco_transf_9 (HMM E-Value=1.9) Length = 930 Score = 28.3 bits (60), Expect = 5.9 Identities = 14/47 (29%), Positives = 26/47 (55%) Frame = -1 Query: 441 IKTHMKMQNQALPCLVLNDISLRKGSLNKRPKRKYDDIVYSEHCELF 301 + ++ ++ P L+L+ L L+K+PKR+ +D+V CE F Sbjct: 165 LPANLSPMSEPEPQLLLDGHLLSSAPLSKKPKRRLEDVV--SWCEAF 209 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,785,695 Number of Sequences: 59808 Number of extensions: 385729 Number of successful extensions: 647 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 586 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 647 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1693527500 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -