BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG1024 (528 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF213012-1|AAG43568.1| 492|Apis mellifera acetylcholinesterase ... 25 0.63 AB181702-1|BAE06051.1| 628|Apis mellifera acetylcholinesterase ... 25 0.63 AY463910-1|AAR24352.1| 843|Apis mellifera metabotropic glutamat... 24 0.84 AB161181-1|BAD08343.1| 933|Apis mellifera metabotropic glutamat... 24 0.84 AF205594-1|AAQ13840.1| 156|Apis mellifera acid phosphatase prec... 22 3.4 >AF213012-1|AAG43568.1| 492|Apis mellifera acetylcholinesterase protein. Length = 492 Score = 24.6 bits (51), Expect = 0.63 Identities = 9/17 (52%), Positives = 12/17 (70%) Frame = -2 Query: 524 VEYKNIQVQQENSFWNV 474 V+ K I VQQ NS+W + Sbjct: 326 VDAKTISVQQWNSYWGI 342 >AB181702-1|BAE06051.1| 628|Apis mellifera acetylcholinesterase protein. Length = 628 Score = 24.6 bits (51), Expect = 0.63 Identities = 9/17 (52%), Positives = 12/17 (70%) Frame = -2 Query: 524 VEYKNIQVQQENSFWNV 474 V+ K I VQQ NS+W + Sbjct: 326 VDAKTISVQQWNSYWGI 342 >AY463910-1|AAR24352.1| 843|Apis mellifera metabotropic glutamate receptor 1 protein. Length = 843 Score = 24.2 bits (50), Expect = 0.84 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = -1 Query: 171 FSGQLHSVKFVSRCARIVKFHSHQFFITRLKKYNFKKNK 55 + L +V F+ VKF H + R + NF+K++ Sbjct: 371 YKNYLLNVSFIDAAGSEVKFDEHGDGLARYEILNFRKSE 409 >AB161181-1|BAD08343.1| 933|Apis mellifera metabotropic glutamate receptor protein. Length = 933 Score = 24.2 bits (50), Expect = 0.84 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = -1 Query: 171 FSGQLHSVKFVSRCARIVKFHSHQFFITRLKKYNFKKNK 55 + L +V F+ VKF H + R + NF+K++ Sbjct: 461 YKNYLLNVSFIDAAGSEVKFDEHGDGLARYEILNFRKSE 499 >AF205594-1|AAQ13840.1| 156|Apis mellifera acid phosphatase precursor protein. Length = 156 Score = 22.2 bits (45), Expect = 3.4 Identities = 9/17 (52%), Positives = 12/17 (70%) Frame = -1 Query: 390 LYFIFIKFISFFHLNFN 340 + F+ I+F SF LNFN Sbjct: 134 IIFLLIRFKSFSLLNFN 150 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 134,534 Number of Sequences: 438 Number of extensions: 2851 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 14845611 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -