BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG1024 (528 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g29810.1 68416.m03794 phytochelatin synthetase family protein... 30 1.1 At3g04080.1 68416.m00432 apyrase (APY1) identical to apyrase (At... 29 2.6 At5g59020.1 68418.m07393 expressed protein 28 3.4 At3g02210.1 68416.m00202 phytochelatin synthetase family protein... 28 3.4 At1g15210.1 68414.m01818 ABC transporter family protein Similar ... 28 3.4 At5g40060.1 68418.m04860 disease resistance protein (TIR-NBS-LRR... 27 5.9 At3g21170.1 68416.m02674 F-box family protein contains Pfam prof... 27 5.9 At5g38000.1 68418.m04576 NADP-dependent oxidoreductase, putative... 27 7.8 >At3g29810.1 68416.m03794 phytochelatin synthetase family protein / COBRA cell expansion protein COBL2 similar to phytochelatin synthetase [Hordeum vulgare subsp. vulgare] GI:29570314; identified in Roudier, et al, Plant Phys. (2002) 130:538-548 (PMID:12376623); contains Pfam profile PF04833: Phytochelatin synthetase-like conserved region Length = 441 Score = 29.9 bits (64), Expect = 1.1 Identities = 20/65 (30%), Positives = 29/65 (44%) Frame = -1 Query: 459 PLLHSTIYIFKKRVRVLMYARKKLYFIFIKFISFFHLNFNQFEKKSITQHPQTRILASLF 280 PLL T ++ RV + K Y+ I+ F+ N N + + QHP L LF Sbjct: 275 PLLQCTQHMCPIRVHWHVKTSYKEYWRVKVAITNFNYNMNYSQWNLVVQHPNFDNLTKLF 334 Query: 279 LTSYK 265 +YK Sbjct: 335 SFNYK 339 >At3g04080.1 68416.m00432 apyrase (APY1) identical to apyrase (Atapy1) GI:6002631 from [Arabidopsis thaliana] Length = 471 Score = 28.7 bits (61), Expect = 2.6 Identities = 12/61 (19%), Positives = 31/61 (50%) Frame = -1 Query: 408 MYARKKLYFIFIKFISFFHLNFNQFEKKSITQHPQTRILASLFLTSYKFGNSRYGSESSP 229 MY + + YF+++ + L + E +++ +A+ + +YK+G + + +SP Sbjct: 255 MYLKGRKYFLYVHSYLHYGLLAARAEILKVSEDSNNPCIATGYAGTYKYGGKAFKAAASP 314 Query: 228 A 226 + Sbjct: 315 S 315 >At5g59020.1 68418.m07393 expressed protein Length = 780 Score = 28.3 bits (60), Expect = 3.4 Identities = 17/53 (32%), Positives = 26/53 (49%) Frame = -1 Query: 306 QTRILASLFLTSYKFGNSRYGSESSPAAIFRLAKTKLRRSYCNERFSGQLHSV 148 +T I+A+ T K G+S G +S F + K + N+R SGQ H + Sbjct: 476 ETDIIAA---TQKKMGSSEEGECTSVYTFFSIKDHKRNSGWLNQRGSGQTHGL 525 >At3g02210.1 68416.m00202 phytochelatin synthetase family protein / COBRA cell expansion protein COBL3 similar to phytochelatin synthetase [Hordeum vulgare subsp. vulgare] GI:29570314; identified in Roudier, et al, Plant Phys. (2002) 130:538-548 (PMID:12376623); supported by cDNA: gi|26452134|dbj|AK118555.1; contains Pfam profile PF04833: Phytochelatin synthetase-like conserved region Length = 452 Score = 28.3 bits (60), Expect = 3.4 Identities = 19/70 (27%), Positives = 30/70 (42%) Frame = -1 Query: 474 NAINWPLLHSTIYIFKKRVRVLMYARKKLYFIFIKFISFFHLNFNQFEKKSITQHPQTRI 295 NA PL+ T ++ R+ + K Y+ I+ F+ N N + + QHP Sbjct: 279 NAYIPPLVQCTKHMCPVRIHWHVKVNYKQYWRVKVTITNFNYNMNYSQWNLVVQHPNFDN 338 Query: 294 LASLFLTSYK 265 L F +YK Sbjct: 339 LTQTFSFNYK 348 >At1g15210.1 68414.m01818 ABC transporter family protein Similar to gb|Z70524 GI:1514643 PDR5-like ABC transporter from Spirodela polyrrhiza and is a member of the PF|00005 ABC transporter family. ESTs gb|N97039 and gb|T43169 come from this gene Length = 1442 Score = 28.3 bits (60), Expect = 3.4 Identities = 20/65 (30%), Positives = 33/65 (50%), Gaps = 2/65 (3%) Frame = -1 Query: 456 LLHSTIY--IFKKRVRVLMYARKKLYFIFIKFISFFHLNFNQFEKKSITQHPQTRILASL 283 L+ +T Y I V A K L+FIFI + SF + + S+T + Q +AS+ Sbjct: 1276 LIQTTYYSLIIYSMVGFEWKASKFLWFIFINYFSFLYWTYYGMMTVSLTPNQQ---VASI 1332 Query: 282 FLTSY 268 F +++ Sbjct: 1333 FASAF 1337 >At5g40060.1 68418.m04860 disease resistance protein (TIR-NBS-LRR class), putative domain signature TIR-NBS-LRR exists, suggestive of a disease resistance protein. False intron created at intron 2 to escape a frameshift in the BAC sequence. Length = 1165 Score = 27.5 bits (58), Expect = 5.9 Identities = 16/33 (48%), Positives = 18/33 (54%), Gaps = 1/33 (3%) Frame = +2 Query: 398 RAYISTRTL-FLNIYMVLCRSGQFIALHSKMNF 493 +A+ R L FLNIY SGQ I LH NF Sbjct: 551 KAFQGMRNLRFLNIYTKALMSGQKIRLHLPENF 583 >At3g21170.1 68416.m02674 F-box family protein contains Pfam profile: PF00646 F-box domain Length = 394 Score = 27.5 bits (58), Expect = 5.9 Identities = 13/35 (37%), Positives = 19/35 (54%) Frame = -1 Query: 294 LASLFLTSYKFGNSRYGSESSPAAIFRLAKTKLRR 190 ++ FL S+ F R+GSES P LA + R+ Sbjct: 233 ISEQFLLSFDFSTERFGSESLPEGDSHLALSVTRQ 267 >At5g38000.1 68418.m04576 NADP-dependent oxidoreductase, putative similar to probable NADP-dependent oxidoreductase (zeta-crystallin homolog) P1 [SP|Q39172][gi:886428] and P2 [SP|Q39173][gi:886430], Arabidopsis thaliana Length = 353 Score = 27.1 bits (57), Expect = 7.8 Identities = 12/33 (36%), Positives = 20/33 (60%) Frame = -1 Query: 456 LLHSTIYIFKKRVRVLMYARKKLYFIFIKFISF 358 +LH+T I KR+RV +A + + + KF+ F Sbjct: 275 VLHNTATIVHKRIRVQGFAAVEFFDRYSKFLDF 307 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,893,756 Number of Sequences: 28952 Number of extensions: 175299 Number of successful extensions: 398 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 395 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 398 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 977150592 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -