BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG1023 (686 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB244761-1|BAE66603.1| 504|Apis mellifera cystathionine beta-sy... 27 0.13 DQ026032-1|AAY87891.1| 566|Apis mellifera nicotinic acetylcholi... 25 0.68 L01587-1|AAA27734.1| 69|Apis mellifera zinc finger protein pro... 24 1.6 DQ667192-1|ABG75744.1| 489|Apis mellifera pH-sensitive chloride... 22 4.8 DQ667191-1|ABG75743.1| 475|Apis mellifera pH-sensitive chloride... 22 4.8 DQ667190-1|ABG75742.1| 509|Apis mellifera pH-sensitive chloride... 22 4.8 DQ667189-1|ABG75741.1| 458|Apis mellifera pH-sensitive chloride... 22 4.8 DQ288391-1|ABC41341.1| 630|Apis mellifera vasa protein protein. 22 4.8 AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precurso... 22 4.8 AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamat... 22 6.3 DQ244074-1|ABB36784.1| 517|Apis mellifera cytochrome P450 monoo... 21 8.3 AF084556-1|AAC71015.1| 652|Apis mellifera pipsqueak protein. 21 8.3 >AB244761-1|BAE66603.1| 504|Apis mellifera cystathionine beta-synthase protein. Length = 504 Score = 27.5 bits (58), Expect = 0.13 Identities = 12/29 (41%), Positives = 17/29 (58%) Frame = +3 Query: 351 FVLALFEEHEDAFSAFVEPFVILLILIAN 437 +V+ L +EH+DAF V F IL + N Sbjct: 467 YVIILDDEHDDAFIGIVNQFHILQFITKN 495 >DQ026032-1|AAY87891.1| 566|Apis mellifera nicotinic acetylcholine receptor alpha3subunit protein. Length = 566 Score = 25.0 bits (52), Expect = 0.68 Identities = 10/18 (55%), Positives = 14/18 (77%) Frame = +3 Query: 603 DKIPADIRLIKIYSTTIR 656 D+IP D+RL +I STT + Sbjct: 542 DRIPIDVRLSEIASTTAK 559 >L01587-1|AAA27734.1| 69|Apis mellifera zinc finger protein protein. Length = 69 Score = 23.8 bits (49), Expect = 1.6 Identities = 12/41 (29%), Positives = 19/41 (46%), Gaps = 2/41 (4%) Frame = -2 Query: 397 KAENASSCSSNKANTNEIIAANSKILTKRSSNCSKTN--CH 281 K E S NK+ N + ++S + R +NC+ CH Sbjct: 18 KCEKCSYSCVNKSMLNSHLKSHSNVYQYRCANCTYATKYCH 58 >DQ667192-1|ABG75744.1| 489|Apis mellifera pH-sensitive chloride channel variant 4 protein. Length = 489 Score = 22.2 bits (45), Expect = 4.8 Identities = 11/29 (37%), Positives = 17/29 (58%) Frame = +1 Query: 598 LVTRSLLTFALSKSTPPQSVSISLS*LVN 684 LVT S +TF L + P V I ++ ++N Sbjct: 314 LVTSSFITFWLEWNAVPARVMIGVTTMLN 342 >DQ667191-1|ABG75743.1| 475|Apis mellifera pH-sensitive chloride channel variant 3 protein. Length = 475 Score = 22.2 bits (45), Expect = 4.8 Identities = 11/29 (37%), Positives = 17/29 (58%) Frame = +1 Query: 598 LVTRSLLTFALSKSTPPQSVSISLS*LVN 684 LVT S +TF L + P V I ++ ++N Sbjct: 283 LVTSSFITFWLEWNAVPARVMIGVTTMLN 311 >DQ667190-1|ABG75742.1| 509|Apis mellifera pH-sensitive chloride channel variant 1 protein. Length = 509 Score = 22.2 bits (45), Expect = 4.8 Identities = 11/29 (37%), Positives = 17/29 (58%) Frame = +1 Query: 598 LVTRSLLTFALSKSTPPQSVSISLS*LVN 684 LVT S +TF L + P V I ++ ++N Sbjct: 334 LVTSSFITFWLEWNAVPARVMIGVTTMLN 362 >DQ667189-1|ABG75741.1| 458|Apis mellifera pH-sensitive chloride channel protein. Length = 458 Score = 22.2 bits (45), Expect = 4.8 Identities = 11/29 (37%), Positives = 17/29 (58%) Frame = +1 Query: 598 LVTRSLLTFALSKSTPPQSVSISLS*LVN 684 LVT S +TF L + P V I ++ ++N Sbjct: 283 LVTSSFITFWLEWNAVPARVMIGVTTMLN 311 >DQ288391-1|ABC41341.1| 630|Apis mellifera vasa protein protein. Length = 630 Score = 22.2 bits (45), Expect = 4.8 Identities = 9/25 (36%), Positives = 19/25 (76%) Frame = +3 Query: 213 DQIKRNQEKYGPNELPTEEGKSIWQ 287 ++ ++ +E+Y P ELP +E KS+++ Sbjct: 144 EEAQKPKEQYIPPELPNDE-KSLFE 167 >AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precursor protein. Length = 1770 Score = 22.2 bits (45), Expect = 4.8 Identities = 13/43 (30%), Positives = 18/43 (41%) Frame = -3 Query: 579 PREQFPWHGFFVLQICLLL*LYPFQVRILLKLRWQIRRFFPAI 451 P E P G ++ L +PF IL KL I + A+ Sbjct: 866 PEELVPLEGNLMINNKYALKFFPFDKHILDKLPTLISNYIEAV 908 >AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamate receptor protein. Length = 1040 Score = 21.8 bits (44), Expect = 6.3 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = +3 Query: 165 EVLKYFGTDPDKGLSPDQIKRNQEKYGP 248 E+LKY +GLS D+ K ++ GP Sbjct: 510 ELLKYLRKVDFEGLSGDKFKFDKNGDGP 537 >DQ244074-1|ABB36784.1| 517|Apis mellifera cytochrome P450 monooxygenase protein. Length = 517 Score = 21.4 bits (43), Expect = 8.3 Identities = 8/23 (34%), Positives = 14/23 (60%) Frame = -3 Query: 177 ILRLLPRISCERPPWWNYYVAVS 109 +L +L ++ RP WW ++ A S Sbjct: 15 LLTILIFVTSHRPAWW-FWTATS 36 >AF084556-1|AAC71015.1| 652|Apis mellifera pipsqueak protein. Length = 652 Score = 21.4 bits (43), Expect = 8.3 Identities = 6/22 (27%), Positives = 15/22 (68%) Frame = +3 Query: 453 WQERNAESAIEALKEYEPEMGK 518 W + + ++A+EAL+ ++ + K Sbjct: 411 WTQEDMDAALEALRNHDMSLTK 432 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 186,674 Number of Sequences: 438 Number of extensions: 3907 Number of successful extensions: 15 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 15 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 15 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 20952180 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -