BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG1019 (623 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC4D7.04c |||cis-prenyltransferase |Schizosaccharomyces pombe|... 30 0.31 SPAC6F6.02c |pof5||F-box protein Pof5|Schizosaccharomyces pombe|... 26 3.8 SPCC417.11c |||glutamate-1-semialdehyde 2,1-aminomutaseaminotran... 26 5.1 SPBC119.13c |prp31||U4/U6 x U5 tri-snRNP complex subunit Prp31|S... 25 6.7 SPBC3D6.03c |||tRNA endonuclease |Schizosaccharomyces pombe|chr ... 25 6.7 SPCC594.05c |||COMPASS complex subunit |Schizosaccharomyces pomb... 25 6.7 >SPAC4D7.04c |||cis-prenyltransferase |Schizosaccharomyces pombe|chr 1|||Manual Length = 264 Score = 29.9 bits (64), Expect = 0.31 Identities = 19/63 (30%), Positives = 32/63 (50%), Gaps = 3/63 (4%) Frame = +2 Query: 29 LEGQAKGVKTCKFSSIKIDLE---KEIGGYEFTCDIDIEGKYKVFSESPLIKNLLGGTTV 199 +EG + G + K S +K+ L+ KE+ + F+ + KY+V + KN L T Sbjct: 57 IEGHSSGFEALK-SLLKVCLKLGVKEVSAFTFSIENFKRSKYEVDMLMEIAKNSLTQITA 115 Query: 200 HGE 208 HG+ Sbjct: 116 HGD 118 >SPAC6F6.02c |pof5||F-box protein Pof5|Schizosaccharomyces pombe|chr 1|||Manual Length = 348 Score = 26.2 bits (55), Expect = 3.8 Identities = 14/45 (31%), Positives = 26/45 (57%), Gaps = 1/45 (2%) Frame = -3 Query: 510 PKNFEV*L*KISMALSKKLLPKVSMTNFQFSFKNVVTS-LLASCS 379 P+N+ + IS ++KL+ +S+ N ++ K +TS LL C+ Sbjct: 53 PRNYHKFVDTISRKPTRKLVHHISLNNVSYASKASITSRLLRRCA 97 >SPCC417.11c |||glutamate-1-semialdehyde 2,1-aminomutaseaminotransferase |Schizosaccharomyces pombe|chr 3|||Manual Length = 435 Score = 25.8 bits (54), Expect = 5.1 Identities = 8/28 (28%), Positives = 20/28 (71%) Frame = +3 Query: 309 IVKLSTIIKFWERQSFMLTISSWVNKKL 392 ++ LS ++ E ++F LTI +W+++++ Sbjct: 403 MITLSLVLTESELEAFKLTIKAWIHRRM 430 >SPBC119.13c |prp31||U4/U6 x U5 tri-snRNP complex subunit Prp31|Schizosaccharomyces pombe|chr 2|||Manual Length = 518 Score = 25.4 bits (53), Expect = 6.7 Identities = 15/46 (32%), Positives = 22/46 (47%), Gaps = 3/46 (6%) Frame = +1 Query: 136 REV*SVFRKPSYKELVGR---HDRPWRRKWKSSIRKTTNQYEISRV 264 R++ + PS K V DRP RR+ IRK QY ++ + Sbjct: 350 RKIEKLLEPPSQKPTVALPVPDDRPKRRRGGRRIRKMKEQYAVTEL 395 >SPBC3D6.03c |||tRNA endonuclease |Schizosaccharomyces pombe|chr 2|||Manual Length = 678 Score = 25.4 bits (53), Expect = 6.7 Identities = 11/38 (28%), Positives = 19/38 (50%) Frame = -3 Query: 198 TVVPPNKFFIRGLSENTLYFPSISISQVNSYPPISFSK 85 T +P N + ++ + LY IS+ SY P+ +K Sbjct: 356 TQLPENTYVLKEETSMVLYDEQCKISESPSYSPVKLAK 393 >SPCC594.05c |||COMPASS complex subunit |Schizosaccharomyces pombe|chr 3|||Manual Length = 424 Score = 25.4 bits (53), Expect = 6.7 Identities = 24/86 (27%), Positives = 38/86 (44%), Gaps = 7/86 (8%) Frame = +2 Query: 71 SIKIDLEKEIGGY--EFTCDIDIEGKY---KVFSESPLIKNLLGGTTVHGEGNGKVQLEK 235 S+K+++E E+ G+ + + DIE + + P + G H GN QL Sbjct: 53 SVKMEVE-EVNGHVDSSSTETDIEMQVIQQPTIPKKPPVSAHRRGPRKH-RGNANSQLNL 110 Query: 236 LQISMKFPVYA--QKRDDGEIYMKCD 307 + P+Y QK DDG + CD Sbjct: 111 STADHQRPLYCICQKPDDGSWMLGCD 136 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,657,557 Number of Sequences: 5004 Number of extensions: 57905 Number of successful extensions: 156 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 150 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 156 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 275671126 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -