BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG1019 (623 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC117466-1|AAI17467.1| 612|Homo sapiens kelch repeat and BTB (P... 31 3.3 BC107691-1|AAI07692.1| 161|Homo sapiens KBTBD3 protein protein. 31 3.3 AK092993-1|BAC04012.1| 608|Homo sapiens protein ( Homo sapiens ... 31 3.3 >BC117466-1|AAI17467.1| 612|Homo sapiens kelch repeat and BTB (POZ) domain containing 3 protein. Length = 612 Score = 31.1 bits (67), Expect = 3.3 Identities = 22/59 (37%), Positives = 33/59 (55%), Gaps = 3/59 (5%) Frame = +2 Query: 254 FPVYAQKRDDGEIYMKCDYSK-IK--YDYQILGKTKFYADNLFLGEQEASKLVTTFLNE 421 F V ++RDDG + + SK +K DY GKTK DN+ + Q +S L +FL++ Sbjct: 81 FEVNMKERDDGSVTITNLSSKAVKAFLDYAYTGKTKITDDNVEMFFQLSSFLQVSFLSK 139 >BC107691-1|AAI07692.1| 161|Homo sapiens KBTBD3 protein protein. Length = 161 Score = 31.1 bits (67), Expect = 3.3 Identities = 22/59 (37%), Positives = 33/59 (55%), Gaps = 3/59 (5%) Frame = +2 Query: 254 FPVYAQKRDDGEIYMKCDYSK-IK--YDYQILGKTKFYADNLFLGEQEASKLVTTFLNE 421 F V ++RDDG + + SK +K DY GKTK DN+ + Q +S L +FL++ Sbjct: 81 FEVNMKERDDGSVTITNLSSKAVKAFLDYAYTGKTKITDDNVEMFFQLSSFLQVSFLSK 139 >AK092993-1|BAC04012.1| 608|Homo sapiens protein ( Homo sapiens cDNA FLJ35674 fis, clone SPLEN2018299. ). Length = 608 Score = 31.1 bits (67), Expect = 3.3 Identities = 22/59 (37%), Positives = 33/59 (55%), Gaps = 3/59 (5%) Frame = +2 Query: 254 FPVYAQKRDDGEIYMKCDYSK-IK--YDYQILGKTKFYADNLFLGEQEASKLVTTFLNE 421 F V ++RDDG + + SK +K DY GKTK DN+ + Q +S L +FL++ Sbjct: 77 FEVNMKERDDGSVTITNLSSKAVKAFLDYAYTGKTKITDDNVEMFFQLSSFLQVSFLSK 135 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 84,639,175 Number of Sequences: 237096 Number of extensions: 1753343 Number of successful extensions: 3176 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3105 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3176 length of database: 76,859,062 effective HSP length: 87 effective length of database: 56,231,710 effective search space used: 6747805200 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -