BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG1019 (623 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g45610.1 68418.m05605 expressed protein 29 2.5 At1g77290.1 68414.m09001 tetrachloro-p-hydroquinone reductive de... 29 2.5 At5g42180.1 68418.m05134 peroxidase 64 (PER64) (P64) (PRXR4) ide... 28 4.4 At3g16470.1 68416.m02101 jacalin lectin family protein contains ... 28 5.8 At1g26270.1 68414.m03205 phosphatidylinositol 3- and 4-kinase fa... 28 5.8 At3g32280.1 68416.m04116 hypothetical protein 27 7.7 At3g22750.1 68416.m02869 protein kinase, putative similar to pro... 27 7.7 At1g53140.1 68414.m06017 dynamin family protein low similarity t... 27 7.7 >At5g45610.1 68418.m05605 expressed protein Length = 633 Score = 29.1 bits (62), Expect = 2.5 Identities = 14/30 (46%), Positives = 20/30 (66%) Frame = -3 Query: 468 LSKKLLPKVSMTNFQFSFKNVVTSLLASCS 379 LSKKLL +N+Q KN+++ LL +CS Sbjct: 215 LSKKLLDIWRTSNYQDPRKNLISELLLACS 244 >At1g77290.1 68414.m09001 tetrachloro-p-hydroquinone reductive dehalogenase-related contains similarity to tetrachloro-p-hydroquinone reductive dehalogenase GI:148689 from [Flavobacterium sp.] Length = 266 Score = 29.1 bits (62), Expect = 2.5 Identities = 10/20 (50%), Positives = 16/20 (80%) Frame = +1 Query: 151 VFRKPSYKELVGRHDRPWRR 210 V R+PSYK+++GR+ WR+ Sbjct: 227 VRRRPSYKKVIGRYFNGWRK 246 >At5g42180.1 68418.m05134 peroxidase 64 (PER64) (P64) (PRXR4) identical to SP|Q43872 Peroxidase 64 precursor (EC 1.11.1.7) (Atperox P64) (PRXR4) (ATP17a) {Arabidopsis thaliana} Length = 317 Score = 28.3 bits (60), Expect = 4.4 Identities = 14/42 (33%), Positives = 19/42 (45%) Frame = +2 Query: 308 YSKIKYDYQILGKTKFYADNLFLGEQEASKLVTTFLNENWKF 433 + I Y I GK+ F +D L KLV + N N +F Sbjct: 247 FDNIYYKMLIQGKSLFSSDESLLAVPSTKKLVAKYANSNEEF 288 >At3g16470.1 68416.m02101 jacalin lectin family protein contains Pfam profile: PF01419 jacalin-like lectin domain; similar to myrosinase-binding protein homolog [Arabidopsis thaliana] GI:2997767 Length = 451 Score = 27.9 bits (59), Expect = 5.8 Identities = 20/63 (31%), Positives = 27/63 (42%), Gaps = 3/63 (4%) Frame = +2 Query: 137 GKYKVFSESPLIKNLLGGTT---VHGEGNGKVQLEKLQISMKFPVYAQKRDDGEIYMKCD 307 G Y + S +PL + GG T G G V + VY + D G +Y+K D Sbjct: 138 GVYIIPSTTPLTPPVSGGLTKLEAQGGRGGDVWDDGGAYDNVKKVYVGQGDSGVVYVKFD 197 Query: 308 YSK 316 Y K Sbjct: 198 YEK 200 >At1g26270.1 68414.m03205 phosphatidylinositol 3- and 4-kinase family protein similar to phosphatidylinositol 4-kinase type-II beta [Homo sapiens] GI:20159767; contains Pfam profile PF00454: Phosphatidylinositol 3- and 4-kinase Length = 630 Score = 27.9 bits (59), Expect = 5.8 Identities = 12/51 (23%), Positives = 24/51 (47%) Frame = +2 Query: 188 GTTVHGEGNGKVQLEKLQISMKFPVYAQKRDDGEIYMKCDYSKIKYDYQIL 340 G + N KLQ+++ FP+ G++ +K D + ++ D +L Sbjct: 54 GLELDRSDNAHTVKRKLQVALNFPIEESSLTFGDLVLKNDLTAVRSDSPLL 104 >At3g32280.1 68416.m04116 hypothetical protein Length = 474 Score = 27.5 bits (58), Expect = 7.7 Identities = 16/54 (29%), Positives = 26/54 (48%) Frame = +2 Query: 170 IKNLLGGTTVHGEGNGKVQLEKLQISMKFPVYAQKRDDGEIYMKCDYSKIKYDY 331 +K+++ G + G +GK L + + V Q R D EI M D K +D+ Sbjct: 172 LKHVIIGGSSGGSNSGKGLANDLYLDVNELVEVQVRSDKEINMMKDKGKTIFDF 225 >At3g22750.1 68416.m02869 protein kinase, putative similar to protein kinase ATMRK1 [Arabidopsis thaliana] gi|2351097|dbj|BAA22079 Length = 378 Score = 27.5 bits (58), Expect = 7.7 Identities = 12/27 (44%), Positives = 16/27 (59%), Gaps = 2/27 (7%) Frame = +3 Query: 147 KCFPKAL--L*RTCWEARPSMAKEMEK 221 +C P AL + + CWEA P EME+ Sbjct: 318 RCCPTALATIMKRCWEANPEKRPEMEE 344 >At1g53140.1 68414.m06017 dynamin family protein low similarity to dynamin-like protein E [Arabidopsis thaliana] GI:19423872; contains Pfam profile PF00350: Dynamin family Length = 817 Score = 27.5 bits (58), Expect = 7.7 Identities = 13/35 (37%), Positives = 20/35 (57%) Frame = -2 Query: 601 LILI*KFSNCLLRFGNRCKVIRKIMLSGYRAEKFR 497 ++++ KF N L F +R +V R + SGY E R Sbjct: 240 IVVVSKFDNRLKEFSDRGEVDRYLSASGYLGENTR 274 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,421,554 Number of Sequences: 28952 Number of extensions: 286736 Number of successful extensions: 767 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 750 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 767 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1265787216 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -