BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG1017 (631 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AM050259-1|CAJ18340.1| 683|Apis mellifera putative H3K9 methylt... 22 5.7 AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precurso... 22 5.7 Z26318-1|CAA81227.1| 544|Apis mellifera royal jelly protein RJP... 21 9.9 DQ000307-1|AAY21180.1| 423|Apis mellifera major royal jelly pro... 21 9.9 AF498306-5|AAM19330.1| 456|Apis mellifera dopamine receptor typ... 21 9.9 AF015267-1|AAC38959.1| 461|Apis mellifera elongation factor-1al... 21 9.9 >AM050259-1|CAJ18340.1| 683|Apis mellifera putative H3K9 methyltransferase protein. Length = 683 Score = 21.8 bits (44), Expect = 5.7 Identities = 8/13 (61%), Positives = 8/13 (61%) Frame = -3 Query: 344 EGLHQCPYTCDVA 306 E QCPYT D A Sbjct: 557 ESEEQCPYTVDAA 569 >AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precursor protein. Length = 1770 Score = 21.8 bits (44), Expect = 5.7 Identities = 11/32 (34%), Positives = 16/32 (50%) Frame = +3 Query: 258 GYIGF*TPFSHG*EITGYITSIRTLMQTLIML 353 G +GF TPF H I+G +++ I L Sbjct: 978 GRVGFVTPFEHRHFISGIDSNLHVYAPLKISL 1009 >Z26318-1|CAA81227.1| 544|Apis mellifera royal jelly protein RJP57-1 protein. Length = 544 Score = 21.0 bits (42), Expect = 9.9 Identities = 7/9 (77%), Positives = 7/9 (77%) Frame = -2 Query: 390 NNQPMCEKK 364 NNQPMC K Sbjct: 151 NNQPMCSPK 159 >DQ000307-1|AAY21180.1| 423|Apis mellifera major royal jelly protein 9 protein. Length = 423 Score = 21.0 bits (42), Expect = 9.9 Identities = 7/11 (63%), Positives = 8/11 (72%) Frame = +3 Query: 369 SHTSAGCWCEN 401 S T+ GCW EN Sbjct: 320 SDTALGCWNEN 330 >AF498306-5|AAM19330.1| 456|Apis mellifera dopamine receptor type D2 protein. Length = 456 Score = 21.0 bits (42), Expect = 9.9 Identities = 9/25 (36%), Positives = 15/25 (60%) Frame = +1 Query: 151 ASPIKHKIVVMNVIRFSYLHIAGLY 225 A+ + +V++ V+R YLH A Y Sbjct: 58 ATVFGNTLVILAVVRERYLHTATNY 82 >AF015267-1|AAC38959.1| 461|Apis mellifera elongation factor-1alpha F2 protein. Length = 461 Score = 21.0 bits (42), Expect = 9.9 Identities = 8/15 (53%), Positives = 10/15 (66%) Frame = -3 Query: 437 CQGSFQQFSPLDVFA 393 C +FQ+F PL FA Sbjct: 411 CAEAFQEFPPLGRFA 425 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 185,185 Number of Sequences: 438 Number of extensions: 3986 Number of successful extensions: 7 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 18826962 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -