BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG1015 (621 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 02_04_0376 - 22474473-22476947 30 1.7 03_05_0783 - 27662178-27662237,27662659-27662700,27662791-276628... 27 9.1 >02_04_0376 - 22474473-22476947 Length = 824 Score = 29.9 bits (64), Expect = 1.7 Identities = 12/30 (40%), Positives = 19/30 (63%) Frame = +1 Query: 31 NRIMILHKLIVSINYSRISTTQGPVVSSYC 120 N +++HKL+ NY ++ T G +VSS C Sbjct: 515 NYTIVIHKLLKERNYGLVARTWGEMVSSGC 544 >03_05_0783 - 27662178-27662237,27662659-27662700,27662791-27662892, 27662991-27663147,27663230-27663307,27663391-27663446, 27663557-27663634,27663736-27663867,27663943-27664078, 27664252-27664403,27665317-27665391,27665476-27665535, 27665865-27665944,27666392-27666462,27666549-27666689, 27667467-27667555,27668657-27668731,27669303-27669401, 27669526-27669572,27669654-27669875,27671485-27671557, 27671650-27671823 Length = 732 Score = 27.5 bits (58), Expect = 9.1 Identities = 11/19 (57%), Positives = 15/19 (78%) Frame = -2 Query: 62 TISLCNIMILLSKTLKLLP 6 T+SLC IM+ ++ LKLLP Sbjct: 470 TVSLCVIMVEITNNLKLLP 488 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,397,166 Number of Sequences: 37544 Number of extensions: 232621 Number of successful extensions: 375 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 368 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 375 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1502076244 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -