BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG1012 (600 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC4B3.04c |nte1||lysophospholipase|Schizosaccharomyces pombe|c... 29 0.52 SPBC215.13 |||sequence orphan|Schizosaccharomyces pombe|chr 2|||... 25 6.4 SPAC31A2.14 |||WD repeat protein, human WRDR48 family|Schizosacc... 25 6.4 SPAC26A3.17c ||SPAC8E11.11|N-methyltransferase |Schizosaccharomy... 25 8.5 >SPCC4B3.04c |nte1||lysophospholipase|Schizosaccharomyces pombe|chr 3|||Manual Length = 1316 Score = 29.1 bits (62), Expect = 0.52 Identities = 17/47 (36%), Positives = 25/47 (53%) Frame = +3 Query: 36 RGLEVLFTQSVCALIIVIHFR*LYLK*NLPREATTPPPSRLSPATTI 176 + L LF S+C +I+V+ +R L LP EA ++L P T I Sbjct: 65 KSLLFLFFVSICVVILVVRYRYLNKYARLPHEAPI-KEAKLGPDTNI 110 >SPBC215.13 |||sequence orphan|Schizosaccharomyces pombe|chr 2|||Manual Length = 534 Score = 25.4 bits (53), Expect = 6.4 Identities = 15/42 (35%), Positives = 21/42 (50%) Frame = -3 Query: 355 SIPGVSLSEGQCGAPVSTSRPHIFTQSSVFSFSNRLTGESST 230 S+ S S AP STS ++ + S V S S+ + SST Sbjct: 188 SVSSTSSSTFSSAAPTSTSSSYLSSSSVVSSSSSPSSSSSST 229 >SPAC31A2.14 |||WD repeat protein, human WRDR48 family|Schizosaccharomyces pombe|chr 1|||Manual Length = 962 Score = 25.4 bits (53), Expect = 6.4 Identities = 10/19 (52%), Positives = 13/19 (68%) Frame = -3 Query: 91 CITIIKAHTDCVKRTSRPR 35 C++ I HTD VKR S P+ Sbjct: 115 CLSTIGEHTDYVKRVSIPK 133 >SPAC26A3.17c ||SPAC8E11.11|N-methyltransferase |Schizosaccharomyces pombe|chr 1|||Manual Length = 357 Score = 25.0 bits (52), Expect = 8.5 Identities = 12/18 (66%), Positives = 14/18 (77%) Frame = -3 Query: 202 RN*LRVYVTIVVAGLRRE 149 RN LR+Y TIV AG+R E Sbjct: 101 RNLLRLYETIVDAGVRSE 118 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,317,504 Number of Sequences: 5004 Number of extensions: 44615 Number of successful extensions: 95 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 92 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 95 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 262236260 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -