BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG1012 (600 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 12_02_1044 - 25649296-25649730 31 0.93 11_01_0491 + 3789264-3789596,3789999-3790071,3790260-3790327,379... 28 5.0 11_01_0340 + 2534998-2535660 27 8.7 >12_02_1044 - 25649296-25649730 Length = 144 Score = 30.7 bits (66), Expect = 0.93 Identities = 17/45 (37%), Positives = 23/45 (51%) Frame = -3 Query: 346 GVSLSEGQCGAPVSTSRPHIFTQSSVFSFSNRLTGESSTWEPFIR 212 GVSLS + PV SR H T+ V S G +++W P +R Sbjct: 99 GVSLSVAEVMPPVKASRAHGCTECGVEFDSASTYGGTTSWAPRLR 143 >11_01_0491 + 3789264-3789596,3789999-3790071,3790260-3790327, 3790754-3790842,3791544-3791715,3791839-3791907, 3792129-3792296,3792666-3792833,3792916-3793011 Length = 411 Score = 28.3 bits (60), Expect = 5.0 Identities = 12/23 (52%), Positives = 17/23 (73%) Frame = -3 Query: 187 VYVTIVVAGLRREGGGVVASRGR 119 V V +VVA +R +GGG+ +RGR Sbjct: 4 VVVVVVVAVMRGDGGGLKGARGR 26 >11_01_0340 + 2534998-2535660 Length = 220 Score = 27.5 bits (58), Expect = 8.7 Identities = 12/30 (40%), Positives = 19/30 (63%) Frame = +1 Query: 292 VAARLILVPRTDPPRGSLLEYLPSPCQCVI 381 +AA +L+P PPR +L LP+PC ++ Sbjct: 1 MAALPVLLPT--PPRSKMLPLLPTPCLVIL 28 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,317,119 Number of Sequences: 37544 Number of extensions: 292303 Number of successful extensions: 681 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 670 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 681 length of database: 14,793,348 effective HSP length: 78 effective length of database: 11,864,916 effective search space used: 1435654836 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -