BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG1012 (600 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_19614| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.9 SB_17996| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.8 SB_27714| Best HMM Match : AA_permease (HMM E-Value=0.29) 27 8.8 >SB_19614| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 603 Score = 29.1 bits (62), Expect = 2.9 Identities = 14/40 (35%), Positives = 21/40 (52%) Frame = -3 Query: 343 VSLSEGQCGAPVSTSRPHIFTQSSVFSFSNRLTGESSTWE 224 VS+ EG C +S R H+F+Q+ F F + +WE Sbjct: 268 VSVGEGSCEGKLSGKRGHLFSQNYPFLFPR---NKECSWE 304 >SB_17996| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 778 Score = 27.5 bits (58), Expect = 8.8 Identities = 12/24 (50%), Positives = 16/24 (66%) Frame = +2 Query: 464 YLEYYHY*TGIIKNILGVNLNIYY 535 Y ++HY TGI NIL + L+ YY Sbjct: 326 YHHHHHYITGIAINILPLLLSTYY 349 >SB_27714| Best HMM Match : AA_permease (HMM E-Value=0.29) Length = 420 Score = 27.5 bits (58), Expect = 8.8 Identities = 12/23 (52%), Positives = 15/23 (65%) Frame = -1 Query: 309 YQPRGHIFLLSHLFFPLATG*LA 241 Y+P H F + +FFP ATG LA Sbjct: 363 YRPGEHFFSVFAVFFPAATGILA 385 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,397,621 Number of Sequences: 59808 Number of extensions: 330195 Number of successful extensions: 605 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 518 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 603 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1451595000 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -