BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG1012 (600 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ080895-1|AAY89541.1| 120|Anopheles gambiae olfactory receptor... 23 5.7 DQ080879-1|AAY89525.1| 120|Anopheles gambiae olfactory receptor... 23 7.5 AJ441131-8|CAD29637.1| 756|Anopheles gambiae putative 5-oxoprol... 23 7.5 AJ439398-7|CAD28130.1| 1344|Anopheles gambiae putative 5-oxoprol... 23 7.5 AJ439353-1|CAD27923.1| 1127|Anopheles gambiae putative Na-K-Cl s... 23 7.5 >DQ080895-1|AAY89541.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 23.4 bits (48), Expect = 5.7 Identities = 14/51 (27%), Positives = 23/51 (45%) Frame = -3 Query: 316 APVSTSRPHIFTQSSVFSFSNRLTGESSTWEPFIRDSNRN*LRVYVTIVVA 164 APV+ +RP +F F ++ W P +R R YV +++A Sbjct: 6 APVTDARPQTPEDCGMFKFQRKILLIFGCWPP-----DRRTRRWYVKVLIA 51 >DQ080879-1|AAY89525.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 23.0 bits (47), Expect = 7.5 Identities = 14/51 (27%), Positives = 23/51 (45%) Frame = -3 Query: 316 APVSTSRPHIFTQSSVFSFSNRLTGESSTWEPFIRDSNRN*LRVYVTIVVA 164 APV+ +RP +F F ++ W P +R R YV +++A Sbjct: 6 APVTDARPQTPEDCGIFKFQRKILLIFGCWPP-----DRLTRRWYVKVLIA 51 >AJ441131-8|CAD29637.1| 756|Anopheles gambiae putative 5-oxoprolinase protein. Length = 756 Score = 23.0 bits (47), Expect = 7.5 Identities = 11/22 (50%), Positives = 14/22 (63%) Frame = +3 Query: 33 IRGLEVLFTQSVCALIIVIHFR 98 +RG +VLF QS L + HFR Sbjct: 265 LRGADVLFMQSDGGLTRMEHFR 286 >AJ439398-7|CAD28130.1| 1344|Anopheles gambiae putative 5-oxoprolinase protein. Length = 1344 Score = 23.0 bits (47), Expect = 7.5 Identities = 11/22 (50%), Positives = 14/22 (63%) Frame = +3 Query: 33 IRGLEVLFTQSVCALIIVIHFR 98 +RG +VLF QS L + HFR Sbjct: 265 LRGADVLFMQSDGGLTRMEHFR 286 >AJ439353-1|CAD27923.1| 1127|Anopheles gambiae putative Na-K-Cl symporter protein. Length = 1127 Score = 23.0 bits (47), Expect = 7.5 Identities = 14/30 (46%), Positives = 17/30 (56%) Frame = -1 Query: 330 RVSAGHQYQPRGHIFLLSHLFFPLATG*LA 241 RVS G Q+ F + +FFP ATG LA Sbjct: 388 RVSKGTQHD----FFSVFSIFFPAATGILA 413 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 585,795 Number of Sequences: 2352 Number of extensions: 11727 Number of successful extensions: 72 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 72 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 72 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 58029966 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -