BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG1010 (628 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory recept... 23 2.1 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 21 6.4 AF263515-1|AAF74207.1| 126|Tribolium castaneum cytochrome P450 ... 21 6.4 >AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory receptor candidate 19 protein. Length = 355 Score = 23.0 bits (47), Expect = 2.1 Identities = 7/19 (36%), Positives = 10/19 (52%) Frame = -3 Query: 422 YYYCIDLYVLPLHQYAQFA 366 YY+C + P H Y F+ Sbjct: 299 YYFCRAFIIFPTHFYCAFS 317 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 21.4 bits (43), Expect = 6.4 Identities = 6/10 (60%), Positives = 8/10 (80%) Frame = -1 Query: 232 NFTVQYWLVK 203 NFT+ YW+ K Sbjct: 2045 NFTIHYWIEK 2054 >AF263515-1|AAF74207.1| 126|Tribolium castaneum cytochrome P450 monooxygenase protein. Length = 126 Score = 21.4 bits (43), Expect = 6.4 Identities = 10/31 (32%), Positives = 17/31 (54%) Frame = +2 Query: 533 YFDVQTSEVVERIISSVLPQKVSRNYFDEKI 625 Y D+Q + +ER+I VL S +Y ++ Sbjct: 39 YNDLQELKYMERVIKEVLRLYPSVHYISREL 69 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 140,392 Number of Sequences: 336 Number of extensions: 2958 Number of successful extensions: 4 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 16083914 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -